Report for Sequence Feature Glyma03g35490
Feature Type: gene_model
Chromosome: Gm03
Start: 42670814
stop: 42672273
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g35490
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G23930 AT
Annotation by Michelle Graham. TAIR10: probable small nuclear ribonucleoprotein G | chr2:10182353-10183026 FORWARD LENGTH=80
SoyBase E_val: 4.00E-48 ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005732 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: small nucleolar ribonucleoprotein complex
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG1780
KOG
Small Nuclear ribonucleoprotein G
JGI ISS
PTHR10553 Panther
SMALL NUCLEAR RIBONUCLEOPROTEIN
JGI ISS
PF01423 PFAM
LSM domain
JGI ISS
UniRef100_B9SWG3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Small nuclear ribonucleoprotein G, putative n=1 Tax=Ricinus communis RepID=B9SWG3_RICCO
SoyBase E_val: 1.00E-46 ISS
UniRef100_C6SVH9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVH9_SOYBN
SoyBase E_val: 9.00E-49 ISS
Expression Patterns of Glyma03g35490
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma03g35490
Paralog Evidence Comments
Glyma19g38130 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g35490 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g197100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g35490
Coding sequences of Glyma03g35490
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g35490.1 sequence type=CDS gene model=Glyma03g35490 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGCAGATCAGGGCAACCACCGGATTTGAAGAAGTACATGGACAAGAAGCTTCAGATCAAGCTGAATGCAAATCGCATGGTTGTTGGTACTCTCCGTGGCTTCGACCAGTTTATGAATTTAGTTGTTGACAACACTGTGGAAGTGAATGGCAATGAGAAAAATGACATAGGGATGGTGGTAATCAGAGGAAATAGTGTGGTCACTGTTGAGGCGCTTGAACCTGTGAACAGGACTTGA
Predicted protein sequences of Glyma03g35490
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g35490.1 sequence type=predicted peptide gene model=Glyma03g35490 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSRSGQPPDLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVVDNTVEVNGNEKNDIGMVVIRGNSVVTVEALEPVNRT*