SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g35400

Feature Type:gene_model
Chromosome:Gm03
Start:42607363
stop:42608262
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g35400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G10120AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G03890.1); Has 57 Blast hits to 57 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 57; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:3130155-3130676 FORWARD LENGTH=173 SoyBaseE_val: 1.00E-33ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6TFV1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TFV1_SOYBN SoyBaseE_val: 4.00E-107ISS
UniRef100_Q9LZC0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Emb|CAB85509.1 n=1 Tax=Arabidopsis thaliana RepID=Q9LZC0_ARATH SoyBaseE_val: 5.00E-30ISS

Expression Patterns of Glyma03g35400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g35400
ParalogEvidenceComments
Glyma19g38020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g35400 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g196300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g35400
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g35400
>Glyma03g35400.1   sequence type=CDS   gene model=Glyma03g35400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAACTGCTTGGTGCTGCAAGAGAACGTTGTGAAGATCGTGAAAACCGATGGGAAAGTTCTTGAATACAAAACACCCATCAAAGTGGAAGAGGTTCTGATACAATTTTCAGGCCATGCAGTATCAGAATCACTCACAGTGCTGCGGTATCTTGAGCCACATACAAAACTTCTTAGAGGGCAGTTATATTACCTAGTGCCTCTGCCACCACCATCACCAAAAACCAACAAGAAGGTGAGGTTTGCGGAACCAGAAGTCCAAGATGTACATAAAAGCAACGTGGTTAGGATTAAGCTGGTTATTAGTAAGCAAGAGCTGCAGAATATGCTGCAGAGTGAAGGGTTTTCGGTCAGTAAGATGTTGTCTCTAGTTCATGAGGATTTGTCTCAAAAGGGTACTGAATATTTGTCTCAAAAGAGTGAGGAAGGGTGGAAACCAGCGTTTGAAAGCATACCTGAAGTAAAGTAG
Predicted protein sequences of Glyma03g35400
>Glyma03g35400.1   sequence type=predicted peptide   gene model=Glyma03g35400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGNCLVLQENVVKIVKTDGKVLEYKTPIKVEEVLIQFSGHAVSESLTVLRYLEPHTKLLRGQLYYLVPLPPPSPKTNKKVRFAEPEVQDVHKSNVVRIKLVISKQELQNMLQSEGFSVSKMLSLVHEDLSQKGTEYLSQKSEEGWKPAFESIPEVK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo