Glyma03g35320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g35320

Feature Type:	gene_model
Chromosome:	Gm03
Start:	42577875
stop:	42578361
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g35320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G36300	AT	Annotation by Michelle Graham. TAIR10: Integral membrane Yip1 family protein \| chr2:15213362-15214129 REVERSE LENGTH=255	SoyBase	E_val: 3.00E-41	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR21236	Panther	GOLGI MEMBRANE PROTEIN YIP1	JGI		ISS
UniRef100_G7L626	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein YIPF5 n=1 Tax=Medicago truncatula RepID=G7L626_MEDTR	SoyBase	E_val: 1.00E-44	ISS
UniRef100_I1JQ19	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JQ19_SOYBN	SoyBase	E_val: 2.00E-56	ISS

Expression Patterns of Glyma03g35320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g35320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g195500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g35320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g35320

Limit To All Plant Sequences

>Glyma03g35320.1   sequence type=CDS   gene model=Glyma03g35320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTAGCCGGTCGAACCGGTAACCTCGATCTCCACACCTGCACCAGCGTCGTCGGTTACTGCCTCTTGCCGGTCGTCATTTTCTCTGCCCTCTCGCTCTTCTTACCGGTCGATGGGGTCATTCGCCTCTCGGTCGCCGCGGTTTTCGTCTTGTGGGCCACCAGGGCCTCCGCCGGACTCGTCGTTTCGTTCGCCGACGGCGGTGACGAACACCGTGGACTCATTGCATACGCATCTTTCTTGATTTACACTCTGTTTTCGTTGCTTGTCATATTCTAG

Predicted protein sequences of Glyma03g35320

Limit To All Plant Sequences

>Glyma03g35320.1   sequence type=predicted peptide   gene model=Glyma03g35320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLAGRTGNLDLHTCTSVVGYCLLPVVIFSALSLFLPVDGVIRLSVAAVFVLWATRASAGLVVSFADGGDEHRGLIAYASFLIYTLFSLLVIF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain