Report for Sequence Feature Glyma03g35230
Feature Type: gene_model
Chromosome: Gm03
Start: 42522870
stop: 42523906
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g35230
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G26820 AT
Annotation by Michelle Graham. TAIR10: ribonuclease 3 | chr1:9292760-9293722 REVERSE LENGTH=222
SoyBase E_val: 5.00E-30 ISS
GO:0007568 GO-bp
Annotation by Michelle Graham. GO Biological Process: aging
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0003723 GO-mf
Annotation by Michelle Graham. GO Molecular Function: RNA binding
SoyBase N/A ISS
GO:0004521 GO-mf
Annotation by Michelle Graham. GO Molecular Function: endoribonuclease activity
SoyBase N/A ISS
GO:0033897 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ribonuclease T2 activity
SoyBase N/A ISS
KOG1642
KOG
Ribonuclease, T2 family
JGI ISS
PTHR11240 Panther
RIBONUCLEASE T2
JGI ISS
PTHR11240:SF1 Panther
S-RIBONUCLEASE
JGI ISS
PF00445 PFAM
Ribonuclease T2 family
JGI ISS
UniRef100_G8A0H1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: S7-RNase n=1 Tax=Medicago truncatula RepID=G8A0H1_MEDTR
SoyBase E_val: 1.00E-36 ISS
UniRef100_I1JQ08 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JQ08_SOYBN
SoyBase E_val: 4.00E-142 ISS
Expression Patterns of Glyma03g35230
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Gene model name correspondences to Glyma03g35230 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g194500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g35230
Coding sequences of Glyma03g35230
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g35230.2 sequence type=CDS gene model=Glyma03g35230 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTGTTTAGTATAAATAGGAGTATTAAGTCCAAAAAAATATTAAAAATCTTTTTTTATCTATATATTTTTTTCTCCGTTTTATTATTCAGAATGTACCCTCTTATGATATGTGTTTTCTCTTTGGTGTTGGTTCTAAATGTACCTATCTCGTTTGCTTCTTATGACTTTTTTATGTTGTCTGAAACATGGCCAGCAACCTACTGTGGAATTAAAAATCGTTTGTTACCATGTGCCAAACAACCAAACACATTCACTATCCATGGACTATGGCCACAAAATCATATTGGTCCTCAGCCAGCATCATGCAGCAACCTCCAAAAGGATAAATTCGATAAAAGAATTATCACTTCTTCCTTGAAGTCAGCACTTGAGACAGGTTGGCCAAATTTAAACACACAAAACGATATGAGATTTTGGGTGACAGAGTGGGACAAACACGGGACTTGTTCATTGAACAAGTTCTCCCAATTTAATTATTTTCGTCTGGCGTTGAAAATCAAGGGAGAGTATAATCTAATGACTATCCTTTCTGGAGAACAAATTGTCCCGCATCATTCAACCGCATATGATAAAAACTCCATAATCCAAGCAATACATGGAGTTATTGACACATACCCTCAACTTACTTGTTATAAATATAACTTGAATAAACAATCATATTACAATCTTTCTGAAATAAGACTATGTTTAGACGACAATGGAAAGAACTACATAAATTGTCCTACTCCTACCACAAACTGTAATGGCAACATGTTATATTGGCCAATATAA
Predicted protein sequences of Glyma03g35230
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g35230.2 sequence type=predicted peptide gene model=Glyma03g35230 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVFSINRSIKSKKILKIFFYLYIFFSVLLFRMYPLMICVFSLVLVLNVPISFASYDFFMLSETWPATYCGIKNRLLPCAKQPNTFTIHGLWPQNHIGPQPASCSNLQKDKFDKRIITSSLKSALETGWPNLNTQNDMRFWVTEWDKHGTCSLNKFSQFNYFRLALKIKGEYNLMTILSGEQIVPHHSTAYDKNSIIQAIHGVIDTYPQLTCYKYNLNKQSYYNLSEIRLCLDDNGKNYINCPTPTTNCNGNMLYWPI*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
