Report for Sequence Feature Glyma03g34970
Feature Type: gene_model
Chromosome: Gm03
Start: 42267699
stop: 42268421
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g34970
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G36450 AT
Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr2:15294303-15294857 REVERSE LENGTH=184
SoyBase E_val: 9.00E-58 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0045893 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0050832 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to fungus
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
PF00847 PFAM
AP2 domain
JGI ISS
UniRef100_B9SRH6 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Dehydration-responsive element-binding protein 1B, putative n=1 Tax=Ricinus communis RepID=B9SRH6_RICCO
SoyBase E_val: 4.00E-68 ISS
UniRef100_I1MD04 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MD04_SOYBN
SoyBase E_val: 5.00E-132 ISS
Expression Patterns of Glyma03g34970
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma03g34970
Paralog Evidence Comments
Glyma19g37670 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g34970 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g191800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g34970
Coding sequences of Glyma03g34970
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g34970.1 sequence type=CDS gene model=Glyma03g34970 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCGTTCCAGCAACGGTGCATCAAGCAGCAGAGCCTCCAATGCTAACACTGGGCGCCACCCTGTGTACCGTGGAGTGAGGCGTAGGAGTAGTGGCAAATGGGTTTCTGAAATCCGTGAACCCAAAAAACCTAACAGGATTTGGTTAGGGACATTTGCCACCCCTGAAATGGCTGCTATTGCCTATGACGTGGCAGCGCTTGCTCTTAAGGGTAAGGATGCTGAACTCAACTTCCCTAACTCGGCTTCCTCCCTCCCCGTCCCCACATCATCTGCTGCTCGCGACATTCAGATGGCTGCGGCTAGCGCCGCAGCCGCTGTCGGAGCTGCGAATGATGCACTTGAAGGAAGCCGAGGAGGGAATGCTTCGGTTTCATTGACGGAAGAGTTTTCAGGGGGAAATTTGAACCACTTTGTGGATGAGGACTTGATCTTTGACATGCCGAATATTCTGGTCAATATGGCTGAAGGAATGCTACTGAGTCCTCCTCGTTTTGATAATTTTGCTGCTACCGACTATGAATACATGGATGAAGATCCTAACCTCTGGGGGTTCCCTAATTACTAG
Predicted protein sequences of Glyma03g34970
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g34970.1 sequence type=predicted peptide gene model=Glyma03g34970 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MRSSNGASSSRASNANTGRHPVYRGVRRRSSGKWVSEIREPKKPNRIWLGTFATPEMAAIAYDVAALALKGKDAELNFPNSASSLPVPTSSAARDIQMAAASAAAAVGAANDALEGSRGGNASVSLTEEFSGGNLNHFVDEDLIFDMPNILVNMAEGMLLSPPRFDNFAATDYEYMDEDPNLWGFPNY*