SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g34821

Feature Type:gene_model
Chromosome:Gm03
Start:42125962
stop:42126684
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g34821
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G52960AT Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein | chr3:19639699-19640403 FORWARD LENGTH=234 SoyBaseE_val: 7.00E-62ISS
GO:0018119GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-cysteine S-nitrosylation SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016209GO-mf Annotation by Michelle Graham. GO Molecular Function: antioxidant activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG0541 KOG Alkyl hydroperoxide reductase/peroxiredoxin JGI ISS
PTHR10430Panther PEROXIREDOXIN-5 JGI ISS
PF08534PFAM Redoxin JGI ISS
UniRef100_G1JT87UniRef Annotation by Michelle Graham. Most informative UniRef hit: Type II peroxiredoxin E n=1 Tax=Vitis vinifera RepID=G1JT87_VITVI SoyBaseE_val: 4.00E-66ISS
UniRef100_I1JPW4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JPW4_SOYBN SoyBaseE_val: 9.00E-85ISS

Expression Patterns of Glyma03g34821
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g34821 not represented in the dataset
Glyma03g34821 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g34821
ParalogEvidenceComments
Glyma19g37500 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g34821 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g190400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g34821
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g34821
>Glyma03g34821.1   sequence type=CDS   gene model=Glyma03g34821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTCCAGGAGGCAACCTTTTCCTACCTCGACTCAGACGGCGAGGTGAAGACGACGACATTGTCGGACCTCACCAATGGGAAGAAGGCGGTGCTGTTCGCGGTCCCCGGCGCGTTCACCCCCACGTGCTCGCAGAAGCACGTGCCTGGCTTCGTGGAGAAATCCGGAGAGCTGAGGGCGAAGGGGGTGGATACAATCGCATGCATTTCGGTCAACGACGCCTTCGTCATGAAGGCATGTAACGGAACCTTCACCAAAGCCATTGGAGTCGAACTCGATCTCAGCGACAAGCCCGTTGGGTTGGGTGTTAGGTCAAGGCGTTACGCGCTTTTGGCCGAGGATGGGGTTGTGAAGCTCTTCAATTTGGAGGAAGGTGGTAGGATTTACTATGCACTGACGCTTTTAATGATCCTTGCTTTGACTTCTGCGATGTGTTTTGATGGTTAG
Predicted protein sequences of Glyma03g34821
>Glyma03g34821.1   sequence type=predicted peptide   gene model=Glyma03g34821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LQEATFSYLDSDGEVKTTTLSDLTNGKKAVLFAVPGAFTPTCSQKHVPGFVEKSGELRAKGVDTIACISVNDAFVMKACNGTFTKAIGVELDLSDKPVGLGVRSRRYALLAEDGVVKLFNLEEGGRIYYALTLLMILALTSAMCFDG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo