Report for Sequence Feature Glyma03g34821
Feature Type: gene_model
Chromosome: Gm03
Start: 42125962
stop: 42126684
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g34821
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G52960 AT
Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein | chr3:19639699-19640403 FORWARD LENGTH=234
SoyBase E_val: 7.00E-62 ISS
GO:0018119 GO-bp
Annotation by Michelle Graham. GO Biological Process: peptidyl-cysteine S-nitrosylation
SoyBase N/A ISS
GO:0042742 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to bacterium
SoyBase N/A ISS
GO:0009505 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009536 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plastid
SoyBase N/A ISS
GO:0009570 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma
SoyBase N/A ISS
GO:0009579 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: thylakoid
SoyBase N/A ISS
GO:0009941 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope
SoyBase N/A ISS
GO:0016209 GO-mf
Annotation by Michelle Graham. GO Molecular Function: antioxidant activity
SoyBase N/A ISS
GO:0016491 GO-mf
Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity
SoyBase N/A ISS
KOG0541
KOG
Alkyl hydroperoxide reductase/peroxiredoxin
JGI ISS
PTHR10430 Panther
PEROXIREDOXIN-5
JGI ISS
PF08534 PFAM
Redoxin
JGI ISS
UniRef100_G1JT87 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Type II peroxiredoxin E n=1 Tax=Vitis vinifera RepID=G1JT87_VITVI
SoyBase E_val: 4.00E-66 ISS
UniRef100_I1JPW4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JPW4_SOYBN
SoyBase E_val: 9.00E-85 ISS
Expression Patterns of Glyma03g34821
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma03g34821
Paralog Evidence Comments
Glyma19g37500 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g34821 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g190400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g34821
Coding sequences of Glyma03g34821
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g34821.1 sequence type=CDS gene model=Glyma03g34821 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
CTCCAGGAGGCAACCTTTTCCTACCTCGACTCAGACGGCGAGGTGAAGACGACGACATTGTCGGACCTCACCAATGGGAAGAAGGCGGTGCTGTTCGCGGTCCCCGGCGCGTTCACCCCCACGTGCTCGCAGAAGCACGTGCCTGGCTTCGTGGAGAAATCCGGAGAGCTGAGGGCGAAGGGGGTGGATACAATCGCATGCATTTCGGTCAACGACGCCTTCGTCATGAAGGCATGTAACGGAACCTTCACCAAAGCCATTGGAGTCGAACTCGATCTCAGCGACAAGCCCGTTGGGTTGGGTGTTAGGTCAAGGCGTTACGCGCTTTTGGCCGAGGATGGGGTTGTGAAGCTCTTCAATTTGGAGGAAGGTGGTAGGATTTACTATGCACTGACGCTTTTAATGATCCTTGCTTTGACTTCTGCGATGTGTTTTGATGGTTAG
Predicted protein sequences of Glyma03g34821
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g34821.1 sequence type=predicted peptide gene model=Glyma03g34821 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
LQEATFSYLDSDGEVKTTTLSDLTNGKKAVLFAVPGAFTPTCSQKHVPGFVEKSGELRAKGVDTIACISVNDAFVMKACNGTFTKAIGVELDLSDKPVGLGVRSRRYALLAEDGVVKLFNLEEGGRIYYALTLLMILALTSAMCFDG*