SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g34710

Feature Type:gene_model
Chromosome:Gm03
Start:42039644
stop:42042130
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g34710
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G03790AT Annotation by Michelle Graham. TAIR10: homeobox 51 | chr5:1004985-1006373 FORWARD LENGTH=235 SoyBaseE_val: 3.00E-45ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010434GO-bp Annotation by Michelle Graham. GO Biological Process: bract formation SoyBaseN/AISS
GO:0010582GO-bp Annotation by Michelle Graham. GO Biological Process: floral meristem determinacy SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0048443GO-bp Annotation by Michelle Graham. GO Biological Process: stamen development SoyBaseN/AISS
GO:0048510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of timing of transition from vegetative to reproductive phase SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000976GO-mf Annotation by Michelle Graham. GO Molecular Function: transcription regulatory region sequence-specific DNA binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
KOG0483 KOG Transcription factor HEX, contains HOX and HALZ domains JGI ISS
PTHR24326Panther FAMILY NOT NAMED JGI ISS
PTHR24326:SF227Panther JGI ISS
PF00046PFAM Homeobox domain JGI ISS
PF02183PFAM Homeobox associated leucine zipper JGI ISS
UniRef100_B9SRL6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Homeobox protein, putative n=1 Tax=Ricinus communis RepID=B9SRL6_RICCO SoyBaseE_val: 1.00E-74ISS
UniRef100_UPI0001B37337UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001B37337 related cluster n=1 Tax=unknown RepID=UPI0001B37337 SoyBaseE_val: 3.00E-162ISS

Expression Patterns of Glyma03g34710
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g34710
ParalogEvidenceComments
Glyma19g37380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g34710 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g189400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g34710
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g34710
>Glyma03g34710.2   sequence type=CDS   gene model=Glyma03g34710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATTGAAAGAAAGAGATCTAGACAGGGAACTGGAGACAGATATGGATTGGCATCACGGCACAAAGCCACTTGTTCCTCGGCCAGAGACCTTAAGCTTCTTCTACAACTATAACTACAACAGTCCATATCCAGGAGTGGAAGTGAAACAAGCAGCATTGATGGAGACAGGAGAAGGGTCAGTTCCAGCATTAATGGACAGCAGAAACAAAGAGAAGAAGAAGCGATTAACAAATAACCAGATAGAGTTATTGGAGAGGAGTTTTCAGGAGGAGATAAAGTTGGACCCTGAAAGGAAGATGAAGCTTTCCAGGGAGCTAGGCCTTCAGCCTCGCCAAATCGCTGTTTGGTTCCAAAATAGACGAACAAGGTGGAAGACCAAGCAGCTTGAGCACTTGTACGATGTGCTTAAACACCAATATGATGTCGTCTCCAACGAAAAGCAAAAGCTTCAAGAAGAGGTTATGAAGTTGAAGGCAATGCTAAGTAAAGAGCAAGGTTTTGGGAAGCAAACATTTGGCTGTTATACAGAAATATCAGGGGAAGAAACAGTAGAAAGCACGTCAGAGGGTCTAACTCTAAGGGGAAAGAGTAACATTGAGCACGTTGCAGATCAAGGCTACTGTTCTTTCACTGTGGAGGATTATAACACCACTGTTTTACTGCCTCCTCACTGTCACTGGCCTGCTGTGCCTTATTAG
Predicted protein sequences of Glyma03g34710
>Glyma03g34710.2   sequence type=predicted peptide   gene model=Glyma03g34710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELKERDLDRELETDMDWHHGTKPLVPRPETLSFFYNYNYNSPYPGVEVKQAALMETGEGSVPALMDSRNKEKKKRLTNNQIELLERSFQEEIKLDPERKMKLSRELGLQPRQIAVWFQNRRTRWKTKQLEHLYDVLKHQYDVVSNEKQKLQEEVMKLKAMLSKEQGFGKQTFGCYTEISGEETVESTSEGLTLRGKSNIEHVADQGYCSFTVEDYNTTVLLPPHCHWPAVPY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo