Glyma03g34560 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g34560

Feature Type:	gene_model
Chromosome:	Gm03
Start:	41956624
stop:	41957513
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g34560

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G09925	AT	Annotation by Michelle Graham. TAIR10: Pollen Ole e 1 allergen and extensin family protein \| chr3:3051868-3052784 REVERSE LENGTH=171	SoyBase	E_val: 2.00E-51	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF01190	PFAM	Pollen proteins Ole e I like	JGI		ISS
UniRef100_G7L4Y8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pistil-specific extensin-like protein n=1 Tax=Medicago truncatula RepID=G7L4Y8_MEDTR	SoyBase	E_val: 1.00E-79	ISS
UniRef100_I1JPT8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JPT8_SOYBN	SoyBase	E_val: 2.00E-123	ISS

Expression Patterns of Glyma03g34560

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g34560

Paralog	Evidence	Comments
Glyma19g37240	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g34560 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g188300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g34560

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g34560

Limit To All Plant Sequences

>Glyma03g34560.1   sequence type=CDS   gene model=Glyma03g34560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGATTTGTAGGAGCTTTGATGATCATTATTGCCTCAATGATAGTGTGTTGTTCCTCAGCTTTGGATGAATCGGGAGTCATTTACGTGGGTGGAAAAGTGCAGTGCCAGGACTGCACCAAGGGCTGGAACGAATGGGTAAATGGTGGCAACCCTATGAAAGGAGTTAAAGTGTCCCTAACATGCATGGACAAGAGAAGTAGGGTTGTGTATTACACGAGTGATACAACAGATGAGTTGGGGCAGTACGACTTGACTGTGAAAAAGTACGTCTATGGCAAAGAATTGGATACAAAAGGATGCTCGGTGAGGTTGGTGTCGTCTTCAGATAATGTTTGCAATATCCTCACTGACTTTGGTGGTGGAAAGTCTGGCGTCAAGCTCAACTACCCAACATCAGTGTATCGCAGTTTGATCAAATACGTGCTCAACCCTTTCTATTACACCACTCCTATGTGCGATAAGCCCGACACTGACGGCTATGATGATTCTGGACCTAATAATCCCCAAGGACAAGGAGGCTATTACTAA

Predicted protein sequences of Glyma03g34560

Limit To All Plant Sequences

>Glyma03g34560.1   sequence type=predicted peptide   gene model=Glyma03g34560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGFVGALMIIIASMIVCCSSALDESGVIYVGGKVQCQDCTKGWNEWVNGGNPMKGVKVSLTCMDKRSRVVYYTSDTTDELGQYDLTVKKYVYGKELDTKGCSVRLVSSSDNVCNILTDFGGGKSGVKLNYPTSVYRSLIKYVLNPFYYTTPMCDKPDTDGYDDSGPNNPQGQGGYY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain