Glyma03g34250 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g34250

Feature Type:	gene_model
Chromosome:	Gm03
Start:	41733165
stop:	41736444
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g34250

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G36835	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast envelope; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 26 Blast hits to 26 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 26; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr2:15449839-15451307 REVERSE LENGTH=124	SoyBase	E_val: 3.00E-55	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1JPR4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JPR4_SOYBN	SoyBase	E_val: 1.00E-83	ISS
UniRef100_Q8W455	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis thaliana RepID=Q8W455_ARATH	SoyBase	E_val: 1.00E-52	ISS

Expression Patterns of Glyma03g34250

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g34250

Paralog	Evidence	Comments
Glyma19g36960	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g34250 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g185300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g34250

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g34250

Limit To All Plant Sequences

>Glyma03g34250.1   sequence type=CDS   gene model=Glyma03g34250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGAAAGGGGGTTCGCTTCAAAAGGACGTGCCATGGAGAGCATCGTCTTCTTCTGCGAAGCCCATCCCCAGAATTCATCACAGTCCGCTTCTTCGCGTTTCTCGAACACCTGTTTCCGATTACGGTATCTCCGTCATGAGGCATCCGGACCCTATAGGGGGTGGATTGGGTGACGAGGCCACAGTGGAACCAGCTGGCCCTGATTGCCTCGTCCCTGGCCAGAAAATGCCCATCCAATTACTTGGCCTTCAGGTCTGGCCAATCCATGTTGACCTGAAGTTTTTGGAACCGGTTGGGCGAGAACTTAAGATGCTTGGAAAGTTCATGGATGACGCTGTTGAACTAATGAACAAATCATTCATAGAGCGCTGA

Predicted protein sequences of Glyma03g34250

Limit To All Plant Sequences

>Glyma03g34250.1   sequence type=predicted peptide   gene model=Glyma03g34250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKGGSLQKDVPWRASSSSAKPIPRIHHSPLLRVSRTPVSDYGISVMRHPDPIGGGLGDEATVEPAGPDCLVPGQKMPIQLLGLQVWPIHVDLKFLEPVGRELKMLGKFMDDAVELMNKSFIER*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain