SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g34225

Feature Type:gene_model
Chromosome:Gm03
Start:41712211
stop:41712942
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g34225
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G39210AT Annotation by Michelle Graham. TAIR10: Major facilitator superfamily protein | chr2:16366287-16368231 REVERSE LENGTH=601 SoyBaseE_val: 6.00E-98ISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0043090GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid import SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR21576Panther UNCHARACTERIZED NODULIN-LIKE PROTEIN JGI ISS
PTHR21576:SF8Panther SUBFAMILY NOT NAMED JGI ISS
PF06813PFAM Nodulin-like JGI ISS
UniRef100_G7ZZA4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nitrate and chloride transporter n=1 Tax=Medicago truncatula RepID=G7ZZA4_MEDTR SoyBaseE_val: 7.00E-96ISS
UniRef100_UPI000233E00BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E00B related cluster n=1 Tax=unknown RepID=UPI000233E00B SoyBaseE_val: 2.00E-149ISS

Expression Patterns of Glyma03g34225
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g34225 not represented in the dataset
Glyma03g34225 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g34225 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g185000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g34225
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g34225
>Glyma03g34225.1   sequence type=CDS   gene model=Glyma03g34225   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGACCTTGATCTACAATGTTCTCACGGGGCGTTGGTTCATGCTCTTTGCATCATTACTCATCATGGCTGCAGCAGGAGCAGCCTACATGTTCGGCATGTACTCTAACGAGGTCAAAACCTCCTTAGGATATGACCAAACCACTCTCAACTTGCTAAGCTTCTTCAAAGATGTTAGTGCCACCGTTGGAATCATCATGAACTTCTTTGGTTACTTCATAATATTTCTTGCTGTCACTGGCCGCATTGCCAAACCCCAAGCGTGGAAAATGTGTCTCTACATTTGCATTGGCTTAAATTCTCAAACTTTCACCAACATGGGTGGTACTGTCACGTGTGTGAAAAACTTCCCTGGAAGCCGTGGCAATGTTTTAGGCTTACTCAAAGGTTACGTTGGTTCAAGTAGTGCCATCGTTGCACAGCTCTACCATGCTTTCTATGGTGATCATAACCCTCAGGCTGTTATTTTACTCATTGCTTGGCTTCCTGCTGCTGTTTCCTTCCTTTTCCTTCCAACAATTCGGATATTCAACAGCGTTCACCATCCCAACGAGAACAAAGTTTTCTACCACCTTCTTTATATTTCACTCGCCCTTGCCGGGTTTCTCATGGTTCTTATAATCATGCAAAACAAGCTCAGTTTCACAAGACCAGAATACGTAACCGTTGGTGTTGTGGTTTTTATCTTTCTCCTTCTCCCACTTGTTGAGGTGTTTTTAGAGAAGAAATAA
Predicted protein sequences of Glyma03g34225
>Glyma03g34225.1   sequence type=predicted peptide   gene model=Glyma03g34225   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKTLIYNVLTGRWFMLFASLLIMAAAGAAYMFGMYSNEVKTSLGYDQTTLNLLSFFKDVSATVGIIMNFFGYFIIFLAVTGRIAKPQAWKMCLYICIGLNSQTFTNMGGTVTCVKNFPGSRGNVLGLLKGYVGSSSAIVAQLYHAFYGDHNPQAVILLIAWLPAAVSFLFLPTIRIFNSVHHPNENKVFYHLLYISLALAGFLMVLIIMQNKLSFTRPEYVTVGVVVFIFLLLPLVEVFLEKK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo