SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g34131

Feature Type:gene_model
Chromosome:Gm03
Start:41607739
stop:41609204
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g34131
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G53220AT Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein | chr3:19722032-19722615 FORWARD LENGTH=126 SoyBaseE_val: 1.00E-44ISS
GO:0006662GO-bp Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
PTHR10438Panther THIOREDOXIN-RELATED JGI ISS
PTHR10438:SF10Panther THIOREDOXIN JGI ISS
PF00085PFAM Thioredoxin JGI ISS
UniRef100_I0BZU9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin-like protein 1 n=1 Tax=Populus tremula x Populus tremuloides RepID=I0BZU9_9ROSI SoyBaseE_val: 3.00E-47ISS
UniRef100_I1JPQ3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JPQ3_SOYBN SoyBaseE_val: 2.00E-57ISS

Expression Patterns of Glyma03g34131
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g34131 not represented in the dataset
Glyma03g34131 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g34131
ParalogEvidenceComments
Glyma19g36850 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g34131 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g184100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g34131
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g34131
>Glyma03g34131.1   sequence type=CDS   gene model=Glyma03g34131   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCGTTCTTACATGAGATATGTATTTGATTCTTATGTTCCGTCACAATATTGTTTGCAGGCTGTTATCAAATATGGCGCTACTTGGTGTCCCGTTTGTATCCAAATTCTCCCAGCATTCTGTAGACTAAGCAATAATTTTCCAAAGCTTACCTTTGTATACACAGACATCAATGAATGCTCGGAAACAACTCAACACATTCGGTACACTCCCACCTTCCAATTTTACCGGAATGGTGAAAAGGTAGATGAAATGTTTGGTGCTGGTGGGGAAGAGAGGCTCCATGATCGCCTGTGGTTGCACTCTTAA
Predicted protein sequences of Glyma03g34131
>Glyma03g34131.1   sequence type=predicted peptide   gene model=Glyma03g34131   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRSYMRYVFDSYVPSQYCLQAVIKYGATWCPVCIQILPAFCRLSNNFPKLTFVYTDINECSETTQHIRYTPTFQFYRNGEKVDEMFGAGGEERLHDRLWLHS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo