SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g34031

Feature Type:gene_model
Chromosome:Gm03
Start:41516510
stop:41516809
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g34031
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G28085AT Annotation by Michelle Graham. TAIR10: SAUR-like auxin-responsive protein family | chr2:11968182-11968556 REVERSE LENGTH=124 SoyBaseE_val: 1.00E-17ISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02519PFAM Auxin responsive protein JGI ISS
UniRef100_B9S0H6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin binding protein, putative n=1 Tax=Ricinus communis RepID=B9S0H6_RICCO SoyBaseE_val: 1.00E-26ISS
UniRef100_UPI0002336F91UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336F91 related cluster n=1 Tax=unknown RepID=UPI0002336F91 SoyBaseE_val: 3.00E-65ISS

Expression Patterns of Glyma03g34031
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g34031 not represented in the dataset
Glyma03g34031 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g34031
ParalogEvidenceComments
Glyma19g36781 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g34031 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g183200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g34031
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g34031
>Glyma03g34031.1   sequence type=CDS   gene model=Glyma03g34031   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGAAACTACAAAGCACTTTCTCACGTCCAAAAGGGGTTATCAAGCAGGGTCATTTTGTGGTGATTGCAACACAAGGGTGGAAGCCAGAGAGGTTCTCTATTGAGTTGGAGTTTTTGGATCACCCAGACTTTGTCAAGTTGTTAAAGCAAGCTGAAGAAGAGTTCGGGTTCTCTCAGGTGGGAGCCCTTGCAATTCCTTGCGAACCAGATGACCTCAAGAGAATTATTGCAAGGAAAAAGAATAGGAACAAGGGTGTTGCTATTTCCTGTTGGGTTAAAGGGATAAGAGTTGCATGA
Predicted protein sequences of Glyma03g34031
>Glyma03g34031.1   sequence type=predicted peptide   gene model=Glyma03g34031   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRKLQSTFSRPKGVIKQGHFVVIATQGWKPERFSIELEFLDHPDFVKLLKQAEEEFGFSQVGALAIPCEPDDLKRIIARKKNRNKGVAISCWVKGIRVA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo