Glyma03g34011 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g34011

Feature Type:	gene_model
Chromosome:	Gm03
Start:	41499301
stop:	41500357
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g34011

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G09870	AT	Annotation by Michelle Graham. TAIR10: SAUR-like auxin-responsive protein family \| chr3:3027555-3027896 REVERSE LENGTH=113	SoyBase	E_val: 3.00E-25	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF02519	PFAM	Auxin responsive protein	JGI		ISS
UniRef100_B9MTE7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: SAUR family protein n=1 Tax=Populus trichocarpa RepID=B9MTE7_POPTR	SoyBase	E_val: 6.00E-28	ISS
UniRef100_UPI0002336F90	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002336F90 related cluster n=1 Tax=unknown RepID=UPI0002336F90	SoyBase	E_val: 2.00E-71	ISS

Expression Patterns of Glyma03g34011

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g34011 not represented in the dataset	Glyma03g34011 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g34011

Paralog	Evidence	Comments
Glyma19g36761	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g34011 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g183000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g34011

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g34011

Limit To All Plant Sequences

>Glyma03g34011.1   sequence type=CDS   gene model=Glyma03g34011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTGGGTCTTGTGTTAAGAAGTTGCAAAAGAGTGTCTCACTACTCTTTGTTCACTCCAACGAAGATCAACTGGAAGCTGCAGCAACATTGGTGCCAGAAGATGTTATGGAGGGACATTTTGCTGTTCTTGCCATCAAGGGTGAAGAAACAAGAAGGTTTGTTGTTAAGTTGGACTACTTGGCTGATCCTATGTTCATGGAACTACTGAACCAGGCTCGAGAGGAGTATGGTTTCAAGCAAAAGGGAGCACTTGCAGTCCCTTGCAGGCCTCAAGAATTACAAAACGTTCTTGATGGTCCAAGAGCCAAAGCTGAAAGGTCTTTTGTGGATGGGAGCGACATGTTTCACCTTCCAAATGTATTAAGGCCCCTCAGCAGAAGCAAGTTTCTTCATGGCATTATGAGCTTTATAAACATCAGACTTTATATTAAAAAGATCATATATTTGTCAAAAAAATAA

Predicted protein sequences of Glyma03g34011

Limit To All Plant Sequences

>Glyma03g34011.1   sequence type=predicted peptide   gene model=Glyma03g34011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLGSCVKKLQKSVSLLFVHSNEDQLEAAATLVPEDVMEGHFAVLAIKGEETRRFVVKLDYLADPMFMELLNQAREEYGFKQKGALAVPCRPQELQNVLDGPRAKAERSFVDGSDMFHLPNVLRPLSRSKFLHGIMSFINIRLYIKKIIYLSKK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain