SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g33803

Feature Type:gene_model
Chromosome:Gm03
Start:41279692
stop:41281551
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g33803
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G37170AT Annotation by Michelle Graham. TAIR10: plasma membrane intrinsic protein 2 | chr2:15613624-15614791 REVERSE LENGTH=285 SoyBaseE_val: 3.00E-117ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0015250GO-mf Annotation by Michelle Graham. GO Molecular Function: water channel activity SoyBaseN/AISS
KOG0223 KOG Aquaporin (major intrinsic protein family) JGI ISS
PTHR19139Panther AQUAPORIN TRANSPORTER JGI ISS
PTHR19139:SF27Panther GLYCEROL UPTAKE FACILITATOR JGI ISS
PF00230PFAM Major intrinsic protein JGI ISS
UniRef100_I1JPM3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JPM3_SOYBN SoyBaseE_val: 3.00E-137ISS
UniRef100_Q2HV44UniRef Annotation by Michelle Graham. Most informative UniRef hit: Aquaporin PIP2-1 n=1 Tax=Medicago truncatula RepID=Q2HV44_MEDTR SoyBaseE_val: 8.00E-124ISS

Expression Patterns of Glyma03g33803
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g33803 not represented in the dataset
Glyma03g33803 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g33803
ParalogEvidenceComments
Glyma19g36535 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g33803 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g180900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g33803
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g33803
>Glyma03g33803.1   sequence type=CDS   gene model=Glyma03g33803   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATATTTGTCCTTGTCTATTGCACTGCTGGGATATCAGGGGGACACATAAACCCGGCGGTAACGTTTGGGTTGTTTCTGGCGAGGAAGGTGTCGCTTATAAGAGCAGTTGGGTACATGGTGGCTCAGGTGTTGGGGGCCATAAGTGGTGTGGGGCTAGTGAAGGCTTTACAGAAGAGCTACTACAACAGGTACAATGGTGGCGTGAACATGCTCGCTGATGGGTACAGCAAAGGAACCGGTTTGGGAGCTGAGATTATTGGCACATTTATTCTTGTCTACACCGTCTTCTCTGCTACCGATCCCAAGAGAGTGGCAAGAGACTCCCATGTTCCCGTGTTGGCACCACTTCCAATTGGGTTTGCGGTGTTCATAGTTCACCTGGCCACCATCCCTATCACCGGCACTGGCATCAACCCAGCCAGAAGCCTAGGGCCTGCTGTCATATTCAACAACGAGAAGGCATGGGATGACCAGTGGATCTTCTGGGTTGGACCCTTCATCGGTGCTGCCATTGCTGCATTCTACCACCAGTCCGTGCTGAGGGCCCAAGCAGCAAAGGCTCTCGGGTCTTTCAGGAGCTCCTCAAACCTGTAA
Predicted protein sequences of Glyma03g33803
>Glyma03g33803.1   sequence type=predicted peptide   gene model=Glyma03g33803   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVGYMVAQVLGAISGVGLVKALQKSYYNRYNGGVNMLADGYSKGTGLGAEIIGTFILVYTVFSATDPKRVARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGPAVIFNNEKAWDDQWIFWVGPFIGAAIAAFYHQSVLRAQAAKALGSFRSSSNL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo