Glyma03g33790 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g33790): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g33790): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g33790

Feature Type:	gene_model
Chromosome:	Gm03
Start:	41273676
stop:	41275932
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g33790

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G01390	AT	Annotation by Michelle Graham. TAIR10: vacuolar membrane ATPase 10 \| chr3:150265-150922 REVERSE LENGTH=110	SoyBase	E_val: 4.00E-44	ISS
GO:0006007	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucose catabolic process	SoyBase	N/A	ISS
GO:0015991	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP hydrolysis coupled proton transport	SoyBase	N/A	ISS
GO:0000325	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016469	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex	SoyBase	N/A	ISS
GO:0016471	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar proton-transporting V-type ATPase complex	SoyBase	N/A	ISS
GO:0046933	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transporting ATP synthase activity, rotational mechanism	SoyBase	N/A	ISS
KOG1772	KOG	Vacuolar H+-ATPase V1 sector, subunit G	JGI		ISS
PTHR12713	Panther	VACUOLAR ATP SYNTHASE SUBUNIT G	JGI		ISS
PTHR12713:SF1	Panther	VACUOLAR ATP SYNTHASE SUBUNIT G	JGI		ISS
PF03179	PFAM	Vacuolar (H+)-ATPase G subunit	JGI		ISS
UniRef100_B9SUA9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar ATP synthase subunit G plant, putative n=1 Tax=Ricinus communis RepID=B9SUA9_RICCO	SoyBase	E_val: 1.00E-53	ISS
UniRef100_C6SV85	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SV85_SOYBN	SoyBase	E_val: 1.00E-70	ISS

Expression Patterns of Glyma03g33790

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g33790 not represented in the dataset	Glyma03g33790 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g33790 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g180700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g33790

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g33790

Limit To All Plant Sequences

>Glyma03g33790.1   sequence type=CDS   gene model=Glyma03g33790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCCAACAGGGGTCAAGGTGGAATTCAACAGTTGCTGGCTGCTGAACAAGAAGCGCAAAGAATTGTCAATGCTGCAAAAAATGAAAAATTGGCTAGACTGAAGCAAGCCAAAGAAGAGGCTGAAAAGGAAATTGCCGAGTATAGGGCTCAGTTGGAGTACGAGTTTCAAAAGAAAGTGTCACAGAGTAGTGGAGATTCTGGTGCTAATGTGAAGAGACTTGAGCAAGAGACAGAAGAAAAGATTCATCACCTGAAAACTGAGGCTGAGAGGATATCAGGGGATGTTGTCTCCATGCTCCTCAAGCATGTAACAAGTGTGAAGAATTAG

Predicted protein sequences of Glyma03g33790

Limit To All Plant Sequences

>Glyma03g33790.1   sequence type=predicted peptide   gene model=Glyma03g33790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASNRGQGGIQQLLAAEQEAQRIVNAAKNEKLARLKQAKEEAEKEIAEYRAQLEYEFQKKVSQSSGDSGANVKRLEQETEEKIHHLKTEAERISGDVVSMLLKHVTSVKN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain