Glyma03g33300 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g33300

Feature Type:	gene_model
Chromosome:	Gm03
Start:	40919854
stop:	40921570
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g33300

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G58090	AT	Annotation by Michelle Graham. TAIR10: Disease resistance-responsive (dirigent-like protein) family protein \| chr3:21512479-21513905 REVERSE LENGTH=271	SoyBase	E_val: 2.00E-42	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_F4J4N3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Disease resistance-responsive (Dirigent-like protein) family protein n=1 Tax=Arabidopsis thaliana RepID=F4J4N3_ARATH	SoyBase	E_val: 8.00E-40	ISS
UniRef100_I1JPH0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JPH0_SOYBN	SoyBase	E_val: 2.00E-113	ISS

Expression Patterns of Glyma03g33300

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g33300

Paralog	Evidence	Comments
Glyma19g36020	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g33300 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g175900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g33300

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g33300

Limit To All Plant Sequences

>Glyma03g33300.1   sequence type=CDS   gene model=Glyma03g33300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGACAATGGAATTAAGCAGCAGTCAAATGCTTCAGCAGCAGGGGTTTATGAATTACCTGGAGAACCTGCTATTGTAATTAATGGGGTGCCTGACATAATCCCTGGTGGCTGCACCATTGCTCCCGGTAATGCTTCAAGCAAGGTTGAAATGCATGCGCCTTCAGGTTTGGGTGAATGGTTTGAAGGGAGGGATGTCCAAAAGTGGTTTATGGGAAGATATTTCTCAGGTATGGTAACTGATTTCGACAAAGATTCTGGGTGGTACAGGGTTCACTATGAAGATGGTGACTCAGAAGATCTTGATTGGCAAGAGTTGGAAGAGGTGCTTCTTCCTTTGGACGTTACAGTTCCGCTCAAGGCATTGGCACGGAGGATTGTCAGAAAAGACAAGAAATCTGTTCCTAAATCTGTTAAGAAGGAAGCTGCTCATTCACAAAATCCCCAAATCAAAAGAAGTACAACAAAAGGAAAGTAG

Predicted protein sequences of Glyma03g33300

Limit To All Plant Sequences

>Glyma03g33300.1   sequence type=predicted peptide   gene model=Glyma03g33300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEDNGIKQQSNASAAGVYELPGEPAIVINGVPDIIPGGCTIAPGNASSKVEMHAPSGLGEWFEGRDVQKWFMGRYFSGMVTDFDKDSGWYRVHYEDGDSEDLDWQELEEVLLPLDVTVPLKALARRIVRKDKKSVPKSVKKEAAHSQNPQIKRSTTKGK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain