SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g33211

Feature Type:gene_model
Chromosome:Gm03
Start:40864909
stop:40869135
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g33211
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G09560AT Annotation by Michelle Graham. TAIR10: Lipin family protein | chr3:2934953-2938673 REVERSE LENGTH=904 SoyBaseE_val: 2.00E-107ISS
GO:0006629GO-bp Annotation by Michelle Graham. GO Biological Process: lipid metabolic process SoyBaseN/AISS
GO:0016036GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008195GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidate phosphatase activity SoyBaseN/AISS
PTHR12181Panther LIPIN JGI ISS
PTHR12181:SF4Panther LIPIN 3-RELATED JGI ISS
PF08235PFAM LNS2 (Lipin/Ned1/Smp2) JGI ISS
UniRef100_G7L0Q2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phosphatidate phosphatase LPIN3 n=1 Tax=Medicago truncatula RepID=G7L0Q2_MEDTR SoyBaseE_val: 2.00E-113ISS
UniRef100_I1NA22UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NA22_SOYBN SoyBaseE_val: 4.00E-120ISS

Expression Patterns of Glyma03g33211
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g33211 not represented in the dataset
Glyma03g33211 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g33211
ParalogEvidenceComments
Glyma19g35930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g33211 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g174900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g33211
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g33211
>Glyma03g33211.1   sequence type=CDS   gene model=Glyma03g33211   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTTTAGTTGGAAAAGATTGGTCACAGTCTGGAGTGGCAAGGCTTTTCTCAGCTATTAAAGAAAATGGATACCAGCTACTGTTTTTGAGTGCCCGTGCTATTGTCCAGGCTTATCTAACCAGGAACTTTTTGCTTAACCTGAAACAGGATGACAAGACCTTACCGAATGGTCCTGTAGTTATTTCACCTGATGGATTATTTCCCTCTCTTTACCGAGAAGTAATAAGAAGGGCACCTCATGAGTTCAAGATTCCTTGTCTAGAGGATATCAAAAGACTTTTCCCTTCTGATTATAATCCGTTCTATGCGGGGTTTTGCAATAGAGACACGGATGAACTTAGTTACAGGAAGATAGGAATCCCGAAGGCCAAGATATTTATTATTAATCCTAAGGGTGAGGTAGCAATAAGTCATCGTATTGATGCAAAATCTTACACATCATTGCACACACTCGTCAAGGATATGTTCCCTCCTACTTCTTTGGTTGAACAGGTGGACTTCAACTCATGGAATTATTGGAGAATGCCTTTTTCAGACGTTGATTAG
Predicted protein sequences of Glyma03g33211
>Glyma03g33211.1   sequence type=predicted peptide   gene model=Glyma03g33211   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPLVGKDWSQSGVARLFSAIKENGYQLLFLSARAIVQAYLTRNFLLNLKQDDKTLPNGPVVISPDGLFPSLYREVIRRAPHEFKIPCLEDIKRLFPSDYNPFYAGFCNRDTDELSYRKIGIPKAKIFIINPKGEVAISHRIDAKSYTSLHTLVKDMFPPTSLVEQVDFNSWNYWRMPFSDVD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo