Glyma03g33110 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g33110

Feature Type:	gene_model
Chromosome:	Gm03
Start:	40776365
stop:	40778181
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g33110

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G02580	AT	Annotation by Michelle Graham. TAIR10: Plant protein 1589 of unknown function \| chr5:579965-580454 FORWARD LENGTH=91	SoyBase	E_val: 4.00E-38	ISS
GO:0006635	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009062	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF09713	PFAM	Plant protein 1589 of unknown function (A thal 3526)	JGI		ISS
UniRef100_G7KVN5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Plant-specific domain TIGR01589 family protein n=1 Tax=Medicago truncatula RepID=G7KVN5_MEDTR	SoyBase	E_val: 3.00E-34	ISS
UniRef100_I1JPE9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JPE9_SOYBN	SoyBase	E_val: 4.00E-59	ISS

Expression Patterns of Glyma03g33110

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g33110

Paralog	Evidence	Comments
Glyma19g35810	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g33110 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g173700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g33110

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g33110

Limit To All Plant Sequences

>Glyma03g33110.1   sequence type=CDS   gene model=Glyma03g33110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGACTCTTCTTCCTCTGCTGCTTATATCCGCCTGGTGCACCGTCTGATAGAGGAGTGTATCCTATTCAACATGAGCAAAGAAGAGTGCATGGAAGCTCTTTCCAAACATGCAAATATCAAGCCGGTTATTACCTCCACCGTTTGGAAGGAGTTAGAGAAGGAGAACAAGGAGTTCTTCGAGGCATACACGAGGAGCAGAGTAGAGAAAGCTTCGGAGAGAGAGACAAGGCAAAGGATCCAGAACGTGGTTTCAGATTCTTCCGAAGAACGAGTTTAG

Predicted protein sequences of Glyma03g33110

Limit To All Plant Sequences

>Glyma03g33110.1   sequence type=predicted peptide   gene model=Glyma03g33110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEDSSSSAAYIRLVHRLIEECILFNMSKEECMEALSKHANIKPVITSTVWKELEKENKEFFEAYTRSRVEKASERETRQRIQNVVSDSSEERV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain