Report for Sequence Feature Glyma03g32930
Feature Type: gene_model
Chromosome: Gm03
Start: 40656166
stop: 40656537
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g32930
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G37530 AT
Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G07795.1); Has 39 Blast hits to 39 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 39; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:15751060-15751428 FORWARD LENGTH=122
SoyBase E_val: 3.00E-34 ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
UniRef100_I1JPD2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JPD2_SOYBN
SoyBase E_val: 1.00E-82 ISS
Expression Patterns of Glyma03g32930
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma03g32930
Paralog Evidence Comments
Glyma19g35640 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g32930 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g172000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g32930
Coding sequences of Glyma03g32930
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g32930.1 sequence type=CDS gene model=Glyma03g32930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCTTTTTTCTGGTTCTCAAACATGGTCCGTATGCACCTCTCATGGCCTGTACTAACCTATGCCGCCACGTGGATAACGCTGCTAATGTTGATGGTGGCAGCGGCGTCTATGTCGCCGCAGGTGGCGTTTGTCTCCGCCATAACGCCTTCCTCTAAATTCTCTCAGAAGTGCAGCAGTGGTGGGTCCATTAGAATGCCCTTGGATGTTCCAGGTGACATCCTGTGTTTCCCTGCTCATATGTTCGTGAGGTCCAAGGTTGATCTAATCGTTCCACCCGTCTTTGCAGCGGTGATTGTAGCGGCTTCTGCTTGCGTGGTTCGTGCTGTGGGCTTGTGGGAGCATGATCAAACTCCTTCAGATGCAAATTAA
Predicted protein sequences of Glyma03g32930
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g32930.1 sequence type=predicted peptide gene model=Glyma03g32930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSFFWFSNMVRMHLSWPVLTYAATWITLLMLMVAAASMSPQVAFVSAITPSSKFSQKCSSGGSIRMPLDVPGDILCFPAHMFVRSKVDLIVPPVFAAVIVAASACVVRAVGLWEHDQTPSDAN*