SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g32720): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g32720): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g32720

Feature Type:gene_model
Chromosome:Gm03
Start:40510400
stop:40511558
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g32720
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G26594AT Annotation by Michelle Graham. TAIR10: response regulator 24 | chr5:9269282-9270254 FORWARD LENGTH=139 SoyBaseE_val: 2.00E-50ISS
GO:0000160GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000156GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphorelay response regulator activity SoyBaseN/AISS
PTHR26402Panther RESPONSE REGULATOR OF TWO-COMPONENT SYSTEM JGI ISS
PTHR26402:SF221Panther JGI ISS
PF00072PFAM Response regulator receiver domain JGI ISS
UniRef100_G7KZK5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Extra response regulator n=1 Tax=Medicago truncatula RepID=G7KZK5_MEDTR SoyBaseE_val: 4.00E-61ISS
UniRef100_I1JPB5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JPB5_SOYBN SoyBaseE_val: 6.00E-92ISS

Proteins Associated with Glyma03g32720
LocusGene SymbolProtein Name
RR34 Root Specific, Response Regulator Type-C

Expression Patterns of Glyma03g32720
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g32720 not represented in the dataset
Glyma03g32720 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g32720
ParalogEvidenceComments
Glyma19g35470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g32720 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g170100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g32720
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g32720
>Glyma03g32720.1   sequence type=CDS   gene model=Glyma03g32720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACATCAAAACTTGGGCACCAAATTAACAGCACTTGTAGTAGATGACAATAAAATCAACCGAAAGATTCATCAAAAGCTGTTGGAGAGTGTTGGAATGAAAAATCAAGGAGTGGAAAATGGCCAAGAAGCAGTGGACATTCATTGCCATGGACAAAGATTTGACCTGATTCTCATGGACATGGATATGCCCATCATGAATGGCATTGAGGCAACAAAGGAACTTCGCTCAATGGGCATTGGTAGCATGATTGTTGGTGTATCATCACGCTGTACGGAAGCAGAAATACGAAAATTTATGGAAGCGGGACTGAATGACTACCATGAGAAACCCTTGAACAATTCTAAGCTTAGTTCACTTCTTGATAAGATCAACCCCAGTTTTACTCGTAATTAG
Predicted protein sequences of Glyma03g32720
>Glyma03g32720.1   sequence type=predicted peptide   gene model=Glyma03g32720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAHQNLGTKLTALVVDDNKINRKIHQKLLESVGMKNQGVENGQEAVDIHCHGQRFDLILMDMDMPIMNGIEATKELRSMGIGSMIVGVSSRCTEAEIRKFMEAGLNDYHEKPLNNSKLSSLLDKINPSFTRN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo