Glyma03g32560 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g32560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g32560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g32560

Feature Type:	gene_model
Chromosome:	Gm03
Start:	40289604
stop:	40289924
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g32560

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G64780	AT	Annotation by Michelle Graham. TAIR10: ammonium transporter 1;2 \| chr1:24061021-24062565 REVERSE LENGTH=514	SoyBase	E_val: 8.00E-42	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0009624	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to nematode	SoyBase	N/A	ISS
GO:0010264	GO-bp	Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process	SoyBase	N/A	ISS
GO:0015695	GO-bp	Annotation by Michelle Graham. GO Biological Process: organic cation transport	SoyBase	N/A	ISS
GO:0015696	GO-bp	Annotation by Michelle Graham. GO Biological Process: ammonium transport	SoyBase	N/A	ISS
GO:0015843	GO-bp	Annotation by Michelle Graham. GO Biological Process: methylammonium transport	SoyBase	N/A	ISS
GO:0072488	GO-bp	Annotation by Michelle Graham. GO Biological Process: ammonium transmembrane transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0008519	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ammonium transmembrane transporter activity	SoyBase	N/A	ISS
PTHR11730	Panther	AMMONIUM TRANSPORTER	JGI		ISS
PTHR11730:SF8	Panther	AMMONIUM TRANSPORTER 1	JGI		ISS
PF00909	PFAM	Ammonium Transporter Family	JGI		ISS
UniRef100_I1JP92	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JP92_SOYBN	SoyBase	E_val: 1.00E-59	ISS
UniRef100_I7C493	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AMT13 n=1 Tax=Citrus trifoliata RepID=I7C493_PONTR	SoyBase	E_val: 2.00E-42	ISS

Expression Patterns of Glyma03g32560

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g32560 not represented in the dataset	Glyma03g32560 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g32560 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma03g32560

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g32560

Limit To All Plant Sequences

>Glyma03g32560.1   sequence type=CDS   gene model=Glyma03g32560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGGTGTTCGGTTGTGGATCCGTGGGCTGCAATCATATGTGGGTTCGTGGCTGCTTGGGTGGTCACTGGGTGCAACTTGCTGGCGGAGAAGTTGAAGTACGATGACCCTCTTGAGGCTGCACAGCTTCATGGTGGGTGTGGCACGTGGGGGATTATCTTCACTGATTTGTTTGCTAAGAAAGAGTATGTGAATGAATTAATGGGAGGGGGTGGAAAGCTCTTGGCTGCACATGTTGTTCAGATTTTGGCCATCACGGTTTGGGTGAGTGTTCTTTGTGTTGCATAA

Predicted protein sequences of Glyma03g32560

Limit To All Plant Sequences

>Glyma03g32560.1   sequence type=predicted peptide   gene model=Glyma03g32560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCSVVDPWAAIICGFVAAWVVTGCNLLAEKLKYDDPLEAAQLHGGCGTWGIIFTDLFAKKEYVNELMGGGGKLLAAHVVQILAITVWVSVLCVA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain