Glyma03g32550 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g32550

Feature Type:	gene_model
Chromosome:	Gm03
Start:	40287446
stop:	40288648
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g32550

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G01435	AT	Annotation by Michelle Graham. TAIR10: Expressed protein \| chr3:166853-167984 REVERSE LENGTH=115	SoyBase	E_val: 8.00E-58	ISS
GO:0006357	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription from RNA polymerase II promoter	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016592	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mediator complex	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PF10280	PFAM	Mediator complex protein	JGI		ISS
UniRef100_I1JP91	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JP91_SOYBN	SoyBase	E_val: 7.00E-79	ISS
UniRef100_Q6ID77	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mediator of RNA polymerase II transcription subunit 11 n=1 Tax=Arabidopsis thaliana RepID=MED11_ARATH	SoyBase	E_val: 4.00E-55	ISS

Expression Patterns of Glyma03g32550

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g32550

Paralog	Evidence	Comments
Glyma19g35290	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g32550 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g168300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g32550

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g32550

Limit To All Plant Sequences

>Glyma03g32550.1   sequence type=CDS   gene model=Glyma03g32550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCACAGGGCCAGACAACTTCATTGCAGAGACTTCAGAATGTAGAAAAGAGAATTGTGAAGGTTTTGGAGCTTGCAGGAGGAGTCATGGATGAGCTTGCAAGCCCTGTTGGTCCTAGGAAGGATGTGGTCCAAAACCACTGCCTTGAGTTCATGCAATTAATCAAGGACATTCAGGTTGCATTGCGTGATGAAATCAAAAGTGCTTGTGAATATCGTCCATTTGAGAAATGTGATTATGGTTCAAGAATAGCCAATGAGATTTGTCACAAGAAAGTGGAATTTATTATGTCCCAGTTGGATGCTATAAAACAAACTGTAGATGAGTATCATGTAGCAGTTTGA

Predicted protein sequences of Glyma03g32550

Limit To All Plant Sequences

>Glyma03g32550.1   sequence type=predicted peptide   gene model=Glyma03g32550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSQGQTTSLQRLQNVEKRIVKVLELAGGVMDELASPVGPRKDVVQNHCLEFMQLIKDIQVALRDEIKSACEYRPFEKCDYGSRIANEICHKKVEFIMSQLDAIKQTVDEYHVAV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain