Glyma03g32305 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g32305): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g32305): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g32305

Feature Type:	gene_model
Chromosome:	Gm03
Start:	40097273
stop:	40099522
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g32305

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G62230	AT	Annotation by Michelle Graham. TAIR10: ERECTA-like 1 \| chr5:24996433-25002130 FORWARD LENGTH=918	SoyBase	E_val: 1.00E-46	ISS
GO:0001708	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell fate specification	SoyBase	N/A	ISS
GO:0002237	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to molecule of bacterial origin	SoyBase	N/A	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0009553	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo sac development	SoyBase	N/A	ISS
GO:0009827	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification	SoyBase	N/A	ISS
GO:0009860	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen tube growth	SoyBase	N/A	ISS
GO:0009886	GO-bp	Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0009965	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis	SoyBase	N/A	ISS
GO:0010103	GO-bp	Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis	SoyBase	N/A	ISS
GO:0048441	GO-bp	Annotation by Michelle Graham. GO Biological Process: petal development	SoyBase	N/A	ISS
GO:0048443	GO-bp	Annotation by Michelle Graham. GO Biological Process: stamen development	SoyBase	N/A	ISS
GO:0048481	GO-bp	Annotation by Michelle Graham. GO Biological Process: ovule development	SoyBase	N/A	ISS
GO:0048507	GO-bp	Annotation by Michelle Graham. GO Biological Process: meristem development	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0004713	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
PTHR24420	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24420:SF474	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00560	PFAM	Leucine Rich Repeat	JGI		ISS
PF07714	PFAM	Protein tyrosine kinase	JGI		ISS
PF08263	PFAM	Leucine rich repeat N-terminal domain	JGI		ISS
UniRef100_B9SKP2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Receptor protein kinase, putative n=1 Tax=Ricinus communis RepID=B9SKP2_RICCO	SoyBase	E_val: 6.00E-81	ISS
UniRef100_UPI000233F444	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233F444 related cluster n=1 Tax=unknown RepID=UPI000233F444	SoyBase	E_val: 9.00E-161	ISS

Expression Patterns of Glyma03g32305

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g32305 not represented in the dataset	Glyma03g32305 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g32305 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g166200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g32305

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g32305

Limit To All Plant Sequences

>Glyma03g32305.1   sequence type=CDS   gene model=Glyma03g32305   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAACGTCTCAAAAGCTTTATGCCCTAGTCTTTCATCTACTCTTTTTTATATTTTTGCTTCCATTGAAAATCACATCATCACTAAGAACAGAAGCAGAAGCCCTTGTCAAATGGAAAAACAGTCTATCCCCTCCTCTTCCTCCCTCTCTTAACTCATCATGGTCCCTCACCAACCTTGCCAACCTTTGCATTTGGGATGCCATTGCTTGTGACAACACTAACACAACAGTCTCACAGATAAACCTGTCTGGTGCTAATCTCACTGGGACTCTCACTGCCTTGGATTTTGCTTTCCTCCCTCACCTCACCCAAATCAACCTCAATGGAAACCACTTTGGTGGGTCAATACCATCAACAATTGGCAACCTCTCCAAGCTCACATTATTGGACTTGGGGAACAACTTATATGAAGGAACACTACCAAATAAGCTAGTTTTTTCCTACAACAATCTCAATGGCACTATTCCCTATCAGCTTATGAATCTCCCTAATGTATGGTACATGGACTTTGGATCAAACCACTTTATAACTCCTCCTGACTGGTCTCATTATTCAAGCATGCCTTCCGTAACTCACCTTGCTTTGGATTTCAATTACTTCACAGCTGAATTCCCGAGTTTCATACTTGAGTGCCATAACTTGACATACCTTGACATCTCTCAGAATGACTGGAATGGCACAATACCAGAATCCATGTCTAGCAATTTGGCCAAGCTGGAATACCTCAACCTCACCAATTCTGGGCTAGAAGGAAAAATCCTTTTGAGTTTAGCAGGTAATAGTTTGACTGGTCCTTTGCCTATGTCCTTAGCTAATCTGGCTAAAATATCAGAATTGGGATTATCAGACAATTTCTTCTCTGGTCAACTTTCTGCTTCACTCATCTCTAATTGGACTCAATTGATCTCCTTGCAAAATCTGTTCTCTGGTCCCATTCCTGAAGAGATTGGAAACCTGAAGGAACTGATAAAGTTAGACCTTTCACAAAACCAATTCTCCAGTCCAATTCCATCAACACTTTGGAATCTGACAAACATTCAAGTTCTGAATCTTTTCTCCAATGAGTTCTCTGGAACCATTCCCATGGATATTGAAAACTTAGCCTCACTGCAAATCTTTGATGTCAGCACCAATTACTTGCATGGGGTGTTGCCAGAGACCAAAAGGCATGATGAGGTGACTGACAAGTGTGACGTGTATAGTTTTGAAGTGGTGGTGTTGGAGATATTCATGGGAAAGCATCCTGGAGAACTCTTGACTACAATGTCTTCAAACGAGTATTTGACATCAACGGAGGAACCTCAGATGCTACTGAAGGATGTGCTTGACCAACGGCTTCCACCTCCAGCAGGCCAATTAGCAGAAGCAGTAGTGTTCATAGTGACCATTGCTTTGGCATGCACACATGCGGCACCAGAGTCCAGACCCTTGATGCGTTTTGTGGCACAATCATAA

Predicted protein sequences of Glyma03g32305

Limit To All Plant Sequences

>Glyma03g32305.1   sequence type=predicted peptide   gene model=Glyma03g32305   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTTSQKLYALVFHLLFFIFLLPLKITSSLRTEAEALVKWKNSLSPPLPPSLNSSWSLTNLANLCIWDAIACDNTNTTVSQINLSGANLTGTLTALDFAFLPHLTQINLNGNHFGGSIPSTIGNLSKLTLLDLGNNLYEGTLPNKLVFSYNNLNGTIPYQLMNLPNVWYMDFGSNHFITPPDWSHYSSMPSVTHLALDFNYFTAEFPSFILECHNLTYLDISQNDWNGTIPESMSSNLAKLEYLNLTNSGLEGKILLSLAGNSLTGPLPMSLANLAKISELGLSDNFFSGQLSASLISNWTQLISLQNLFSGPIPEEIGNLKELIKLDLSQNQFSSPIPSTLWNLTNIQVLNLFSNEFSGTIPMDIENLASLQIFDVSTNYLHGVLPETKRHDEVTDKCDVYSFEVVVLEIFMGKHPGELLTTMSSNEYLTSTEEPQMLLKDVLDQRLPPPAGQLAEAVVFIVTIALACTHAAPESRPLMRFVAQS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain