Glyma03g31920 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g31920

Feature Type:	gene_model
Chromosome:	Gm03
Start:	39739652
stop:	39740651
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g31920

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G31230	AT	Annotation by Michelle Graham. TAIR10: ethylene-responsive element binding factor 15 \| chr2:13306676-13307407 REVERSE LENGTH=243	SoyBase	E_val: 1.00E-43	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009873	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF00847	PFAM	AP2 domain	JGI		ISS
UniRef100_C6TE23	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TE23_SOYBN	SoyBase	E_val: 6.00E-170	ISS
UniRef100_G7JJR7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor 1B n=1 Tax=Medicago truncatula RepID=G7JJR7_MEDTR	SoyBase	E_val: 4.00E-46	ISS

Expression Patterns of Glyma03g31920

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g31920

Paralog	Evidence	Comments
Glyma19g34661	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g31920 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g162500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g31920

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g31920

Limit To All Plant Sequences

>Glyma03g31920.1   sequence type=CDS   gene model=Glyma03g31920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTTTAATTCTTCTCTATTTTCATGCCAAAGTCTAGAATCCCATCTCAATTCATGGGAAGAGCTGTTTTCGTTCAACAACCTTCCCTTGAATGCAACAAATGAATCGTCCTTGGACTCCAAATCTTCATCCTCCAATGAAGGAATAATGGAGTCACAAGAAATCACCTCCAATATTACATGTGACGGCCACGTTGAAGAAAAATATTCACCACCACCATCACTACTAGATGGTTCTAAGCGAGAGAAGAGGACCTATAGAGGAGTAAGAAGCAGGCCATGGGGAAAATTCGCAGCAGAAATAAGAGACCCCACAAGAAATGGGGTTCGAGTATGGATTGGAACATTTGTCTCTGCTGAAGAAGCTGCTTTGGCTTATGACCAAGCAGCTTTCTTGACAAGGGGTGTTCTGGCTACCCTTAACTTTTCAGTGCAAGTGGTGATGGAGTCCCTTCAAGACATGGGTTTCAAGGCATTGAAAAATGATCTCTCACCCGTGTTGGCACTCAAGAGGATGCACGTGACGAGAACAAAATCTAGGGCTAGTAGGAGTGGAAACAAAAAGGTTAAAAGGGCTTGCGGCAGCAACGGGAAATGGGACACTAGTACTCAAAATTTGTTGGTGTTGGAGGATTTGGGTCCTGAATACCTAGACCAACTTTTGAGCTTCACTTGCCCTGGTTCTTGGTGCTGA

Predicted protein sequences of Glyma03g31920

Limit To All Plant Sequences

>Glyma03g31920.1   sequence type=predicted peptide   gene model=Glyma03g31920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDFNSSLFSCQSLESHLNSWEELFSFNNLPLNATNESSLDSKSSSSNEGIMESQEITSNITCDGHVEEKYSPPPSLLDGSKREKRTYRGVRSRPWGKFAAEIRDPTRNGVRVWIGTFVSAEEAALAYDQAAFLTRGVLATLNFSVQVVMESLQDMGFKALKNDLSPVLALKRMHVTRTKSRASRSGNKKVKRACGSNGKWDTSTQNLLVLEDLGPEYLDQLLSFTCPGSWC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain