Glyma03g31580 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g31580

Feature Type:	gene_model
Chromosome:	Gm03
Start:	39456582
stop:	39457842
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g31580

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G30570	AT	Annotation by Michelle Graham. TAIR10: photosystem II reaction center W \| chr2:13019326-13020053 REVERSE LENGTH=133	SoyBase	E_val: 4.00E-41	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0009657	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastid organization	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0042549	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II stabilization	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009523	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: photosystem II	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF07123	PFAM	Photosystem II reaction centre W protein (PsbW)	JGI		ISS
UniRef100_B9S4T1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Photosystem II reaction center W protein, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9S4T1_RICCO	SoyBase	E_val: 5.00E-40	ISS
UniRef100_I1JNZ8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JNZ8_SOYBN	SoyBase	E_val: 5.00E-81	ISS

Expression Patterns of Glyma03g31580

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g31580

Paralog	Evidence	Comments
Glyma19g34410	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g31580 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g159100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g31580

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g31580

Limit To All Plant Sequences

>Glyma03g31580.2   sequence type=CDS   gene model=Glyma03g31580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCTCAAACGACCTGTTGGGGCCTCATCCTCTACCGTTCTTGATTGCAAACATAAATTGTACAGGATTGCCAGCAATGGCCAAGGCGGGGAGAGTGAGGTGCTCCATGGAGGAAAAGCCTTCAAGCAGCTCAAACCTAGGGATGGGGGCATCCTTGTTAGCAGCTGCAGCTGCCGCAACCATGTCAAGCCCAGCAGCCATGGCTTTGGTTGATGAGAGACTCAGCACTGAAGGAACTGGGCTTCCCTTTGGGCTTAGCAACAACCTTCTTGGTTGGATCCTGTTTGGTGTCTTTGGTCTCATATGGGCTCTCTTCTTTGTCTACACTTCCACCCTTGAAGAGGATGAAGAGTCTGGATTGTCCCTCTAA

Predicted protein sequences of Glyma03g31580

Limit To All Plant Sequences

>Glyma03g31580.2   sequence type=predicted peptide   gene model=Glyma03g31580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCSNDLLGPHPLPFLIANINCTGLPAMAKAGRVRCSMEEKPSSSSNLGMGASLLAAAAAATMSSPAAMALVDERLSTEGTGLPFGLSNNLLGWILFGVFGLIWALFFVYTSTLEEDEESGLSL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain