Report for Sequence Feature Glyma03g31470
Feature Type: gene_model
Chromosome: Gm03
Start: 39370121
stop: 39371173
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g31470
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G51510 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast thylakoid membrane, chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 42 Blast hits to 42 proteins in 19 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 40; Viruses - 0; Other Eukaryotes - 2 (source: NCBI BLink). | chr3:19109118-19109842 FORWARD LENGTH=181
SoyBase E_val: 1.00E-55 ISS
GO:0000023 GO-bp
Annotation by Michelle Graham. GO Biological Process: maltose metabolic process
SoyBase N/A ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0019252 GO-bp
Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process
SoyBase N/A ISS
GO:0043085 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009535 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_C6SXN7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SXN7_SOYBN
SoyBase E_val: 4.00E-127 ISS
UniRef100_Q9SCZ8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: AT3g51510/F26O13_150 n=1 Tax=Arabidopsis thaliana RepID=Q9SCZ8_ARATH
SoyBase E_val: 5.00E-53 ISS
Expression Patterns of Glyma03g31470
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Gene model name correspondences to Glyma03g31470 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g158200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g31470
Coding sequences of Glyma03g31470
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g31470.1 sequence type=CDS gene model=Glyma03g31470 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAGCGAGTGACGGTTGCAGCAGCTTCTTAACATTGTCGTGTGCAGGTGCAGTGCAAAATCAACATGTATCACACCCTACAACGTTTTTGGGAGTTCCTAAAAACAATCAGAGAAAAAGGAAAACACCGCACAGGTTAGTTGTGGTTGCGGTGACTCAAGGCTCTGCTGAATCAAGCAAGTCCGATGAAAAAATCCCTTCGTGGGCCAAACCGGACTCCGATGAACCTCCGCCGTGGGCCCGGGACGAGCCCAACAACAACAGTTCGCAACAAGAAGGATTTGAGATCCCGTTCTATGCTTATTTGTTTGCCTCTGCTATCACTGCTATTGCCGCTATAGGCTCCATTTTCGAATATGTGAATCAAAAGCCTGTTTTCGGAGTATTAAGCTCTGACAGCGTGTTTTATGCTCCCTTGCTTGGTTTTTTTGTCTTCACCGGCATTCCCTCATCGGCTTTTCTGTGGTTCAAGTCCGTTCAAGCTGCTAACAAGGAAGCGGAGGAACAAGATAAGAGGGATGGCTATTTGTAG
Predicted protein sequences of Glyma03g31470
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g31470.1 sequence type=predicted peptide gene model=Glyma03g31470 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAASDGCSSFLTLSCAGAVQNQHVSHPTTFLGVPKNNQRKRKTPHRLVVVAVTQGSAESSKSDEKIPSWAKPDSDEPPPWARDEPNNNSSQQEGFEIPFYAYLFASAITAIAAIGSIFEYVNQKPVFGVLSSDSVFYAPLLGFFVFTGIPSSAFLWFKSVQAANKEAEEQDKRDGYL*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
