SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g31460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g31460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g31460

Feature Type:gene_model
Chromosome:Gm03
Start:39367670
stop:39369390
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G54560AT Annotation by Michelle Graham. TAIR10: histone H2A 11 | chr3:20196532-20197466 FORWARD LENGTH=136 SoyBaseE_val: 3.00E-78ISS
GO:0006338GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin remodeling SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0010468GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of gene expression SoyBaseN/AISS
GO:0016048GO-bp Annotation by Michelle Graham. GO Biological Process: detection of temperature stimulus SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0044030GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA methylation SoyBaseN/AISS
GO:0000786GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleosome SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG1757 KOG Histone 2A JGI ISS
PTHR23430Panther HISTONE H2A JGI ISS
PF00125PFAM Core histone H2A/H2B/H3/H4 JGI ISS
UniRef100_C6T0M3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histone H2A n=1 Tax=Glycine max RepID=C6T0M3_SOYBN SoyBaseE_val: 3.00E-89ISS
UniRef100_UPI000189DA6FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000189DA6F related cluster n=1 Tax=unknown RepID=UPI000189DA6F SoyBaseE_val: 1.00E-90ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g31460 not represented in the dataset

Glyma03g31460 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma19g34300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g158100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g31460.1   sequence type=CDS   gene model=Glyma03g31460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGGAAAAGGAGGGAAGGGGCTTGTGGCCGGAAAAACCACGGCAGCGAACAAGGACAAAGACAAGGATAAGAAGAGGCCCGTCTCTCGTTCATCCCGTGCTGGGATCCAGTTTCCTGTGGGACGTATCCACAGGCAGTTGAAGCAAAGGGTGCAAGCAAATGGACGTGTGGGGGCGACTGCTGCTGTGTACTTGGCCTCCATTCTGGAATATCTGACTGCTGAGGTGCTGGAGCTGGCAGGGAATGCTAGCAAAGATCTTAAGGTGAAGAGGATCACACCAAGGCACTTGCAACTTGCTATCAGGGGAGATGAAGAACTTGATACCCTCATCAAAGGGACCATTGCTGGCGGTGGTGTCATCCCTCACATTCACAAGTCTTTGATCAACAAAGCGGCCAAAGAATGA

>Glyma03g31460.1   sequence type=predicted peptide   gene model=Glyma03g31460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGKGGKGLVAGKTTAANKDKDKDKKRPVSRSSRAGIQFPVGRIHRQLKQRVQANGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKAAKE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo