Report for Sequence Feature Glyma03g31030
Feature Type: gene_model
Chromosome: Gm03
Start: 38904267
stop: 38908791
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g31030
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G63120 AT
Annotation by Michelle Graham. TAIR10: cyclin p1;1 | chr3:23323143-23323893 REVERSE LENGTH=221
SoyBase E_val: 4.00E-62 ISS
GO:0000079 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of cyclin-dependent protein kinase activity
SoyBase N/A ISS
GO:0010440 GO-bp
Annotation by Michelle Graham. GO Biological Process: stomatal lineage progression
SoyBase N/A ISS
GO:0051726 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0004693 GO-mf
Annotation by Michelle Graham. GO Molecular Function: cyclin-dependent protein kinase activity
SoyBase N/A ISS
GO:0019901 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein kinase binding
SoyBase N/A ISS
KOG1674
KOG
Cyclin
JGI ISS
PTHR15615 Panther
UNCHARACTERIZED
JGI ISS
PF08613 PFAM
Cyclin
JGI ISS
UniRef100_B9S423 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Cyclin-dependent protein kinase, putative n=1 Tax=Ricinus communis RepID=B9S423_RICCO
SoyBase E_val: 8.00E-118 ISS
UniRef100_I1JNU3 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JNU3_SOYBN
SoyBase E_val: 2.00E-158 ISS
Expression Patterns of Glyma03g31030
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma03g31030
Paralog Evidence Comments
Glyma19g33860 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g31030 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g153800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g31030
Coding sequences of Glyma03g31030
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g31030.1 sequence type=CDS gene model=Glyma03g31030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGAGTCTTGCTCTTGAAACCGAGGATGTAATCTCAGATATATACCTTTCACTGGGACTTAAGGAATCAGACAAAGGAGTAGGAGTTCCTCGAGTTTTATCTCTTCTCTCTTCACTTCTTGAGAGATCAGTTCAGAGAAACGAAACGCTATTGGAGGCAAAGCACGTAAAAGATGTAGTTACAGTATTTCACGGTTTAAGAGCTCCTACTCTGAGCGTTCGAAAGTACATTGATCGTATCTTCAAGTACTCAGGTTGCAGCCCATCATGCTTTGTCGTGGCACACATATATGTGGACAGATTCATTCAACACACAGAAATCAAATTGACTTCACTTAATGTGCACCGGCTTCTGATAACAAGCATCATGCTAGCAGCAAAGTTTATAGATGACGCATTCTACAACAATGCTTACTATGCAAAAGTTGGAGGAGTGAGCACGTCTGAATTAAACAGGTTGGAGATGAGCTTTCTATTTGGCATAGATTTTAGGCTTCAGTTTAGTGTAGACACGTTTGGAAGATATTGTAGGCAATTGGAGAAAGAAGCTGCAGAAGTAGTCCAAATTGAAAGGCCAATGCAGGCTTGTCGAATTAAAGAAAGTTGGTCAAACAAAGATGATCCTACCTGTGCTTCCACAATTGCAAGATAA
Predicted protein sequences of Glyma03g31030
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g31030.1 sequence type=predicted peptide gene model=Glyma03g31030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASLALETEDVISDIYLSLGLKESDKGVGVPRVLSLLSSLLERSVQRNETLLEAKHVKDVVTVFHGLRAPTLSVRKYIDRIFKYSGCSPSCFVVAHIYVDRFIQHTEIKLTSLNVHRLLITSIMLAAKFIDDAFYNNAYYAKVGGVSTSELNRLEMSFLFGIDFRLQFSVDTFGRYCRQLEKEAAEVVQIERPMQACRIKESWSNKDDPTCASTIAR*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
