SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g31021): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g31021): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g31021

Feature Type:gene_model
Chromosome:Gm03
Start:38900386
stop:38901285
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G09960AT Annotation by Michelle Graham. TAIR10: sucrose transporter 4 | chr1:3244258-3246718 FORWARD LENGTH=510 SoyBaseE_val: 4.00E-26ISS
GO:0015770GO-bp Annotation by Michelle Graham. GO Biological Process: sucrose transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005887GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005351GO-mf Annotation by Michelle Graham. GO Molecular Function: sugar:hydrogen symporter activity SoyBaseN/AISS
GO:0008506GO-mf Annotation by Michelle Graham. GO Molecular Function: sucrose:hydrogen symporter activity SoyBaseN/AISS
GO:0008515GO-mf Annotation by Michelle Graham. GO Molecular Function: sucrose transmembrane transporter activity SoyBaseN/AISS
GO:0015144GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate transmembrane transporter activity SoyBaseN/AISS
PTHR19432Panther SUCROSE TRANSPORT PROTEIN JGI ISS
PTHR19432:SF2Panther PROSTEIN PROTEIN JGI ISS
UniRef100_Q84RQ3UniRef Annotation by Michelle Graham. Best UniRef hit: Sucrose transporter 4 protein n=1 Tax=Lotus japonicus RepID=Q84RQ3_LOTJA SoyBaseE_val: 1.00E-33ISS
UniRef100_Q84RQ3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Sucrose transporter 4 protein n=1 Tax=Lotus japonicus RepID=Q84RQ3_LOTJA SoyBaseE_val: 1.00E-33ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g31021 not represented in the dataset

Glyma03g31021 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g153700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g31021.2   sequence type=transcript   gene model=Glyma03g31021   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGTAAAATTGAATTTCATATGCCCTCCCCGACCGAGTTAATGATTCAGGATATATAACGTGGTTTGTTGAATTCGTTTCGTATGGTTATAAATATTGACATGTGAACTTTCTCACATGATCATATGTCTAATGTCTGCATCATGTGAATATGGCGGCAATTGTTGTTGGTGCAACAGAAACATCAATTAGCACATCTAGACAGCTAGGAATCCCCCATCAATGTGCCAGCATCATTTGGATCTGCGGCCCAGTCCTCGACCTCTTCATGCAGCCCCTTATCGGCCACATTAATGACCGTTGCACTAGCCGCTTCGACCGTCGTAGGCCCTTCATCCTCATCGATGTCGTCATCATCTTTGTCGTTGTCCTTATCATTGCTTACACCGCCAACATCAGTTGGCTCCTCAGTGACACCACGGACTACCACCCTGTTACCATCACTATCTTCATTATCGACTTTTAGATCCTCAACATTGCCAACAACGTCACACAAAGATCTCTTCGTGCCTTGCTCAATGATATCACTAGCAAGCTAACTCTCTCTCTCTCTTTTGTCTTCTCTTTGTTTGTTGAATTTGTAATTGCTAATTGAAGTTATAATTGTTTATGATGA

>Glyma03g31021.1   sequence type=CDS   gene model=Glyma03g31021   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGCAATTGTTGTTGGTGCAACAGAAACATCAATTAGCACATCTAGACAGCAGCTAGGAATCCCCCATCAATGTGCCAGCATCATTTGGATCTGCGGCCCAGTCCTCGACCTCTTCATGCAGCCCCTTATCGGCCACATTAATGACCGTTGCACTAGCCGCTTCGACCGTCGTAGGCCCTTCATCCTCATCGATGTCGTCATCATCTTTGTCGTTGTCCTTATCATTGCTTACACCGCCAACATCAGTTGGCTCCTCAGTGACACCACGGACTACCACCCTGTTACCATCACTATCTTCATTATCGACTTTTAG

>Glyma03g31021.2   sequence type=CDS   gene model=Glyma03g31021   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGCAATTGTTGTTGGTGCAACAGAAACATCAATTAGCACATCTAGACAGCTAGGAATCCCCCATCAATGTGCCAGCATCATTTGGATCTGCGGCCCAGTCCTCGACCTCTTCATGCAGCCCCTTATCGGCCACATTAATGACCGTTGCACTAGCCGCTTCGACCGTCGTAGGCCCTTCATCCTCATCGATGTCGTCATCATCTTTGTCGTTGTCCTTATCATTGCTTACACCGCCAACATCAGTTGGCTCCTCAGTGACACCACGGACTACCACCCTGTTACCATCACTATCTTCATTATCGACTTTTAG

>Glyma03g31021.1   sequence type=predicted peptide   gene model=Glyma03g31021   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAIVVGATETSISTSRQQLGIPHQCASIIWICGPVLDLFMQPLIGHINDRCTSRFDRRRPFILIDVVIIFVVVLIIAYTANISWLLSDTTDYHPVTITIFIIDF*

>Glyma03g31021.2   sequence type=predicted peptide   gene model=Glyma03g31021   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAIVVGATETSISTSRQLGIPHQCASIIWICGPVLDLFMQPLIGHINDRCTSRFDRRRPFILIDVVIIFVVVLIIAYTANISWLLSDTTDYHPVTITIFIIDF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo