Report for Sequence Feature Glyma03g30923
Feature Type: gene_model
Chromosome: Gm03
Start: 38774808
stop: 38775179
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g30923
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
PF01657 PFAM
Domain of unknown function DUF26
JGI ISS
UniRef100_A4ZDL6 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Antifungal protein ginkbilobin-2 n=3 Tax=Ginkgo biloba RepID=GNK2_GINBI
SoyBase E_val: 3.00E-06 ISS
UniRef100_I1N9G5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N9G5_SOYBN
SoyBase E_val: 2.00E-68 ISS
Expression Patterns of Glyma03g30923
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma03g30923
Paralog Evidence Comments
Glyma19g33750 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g30923 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g152600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g30923
Coding sequences of Glyma03g30923
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g30923.1 sequence type=CDS gene model=Glyma03g30923 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGCATTAATCCAACAAAATGCGTAACAATTGCAATTGGTTTGTTGTGCCTGTGTTGTGTTGCTGACAGTGTTCCCAACACCAGCATCATCAACGTTCTCTGCAACAATGGGGTGTACACTTCAGGGGAGTTAGAGGAAGAAACACCAGCACAGAGGAATTATGACTACCACAACATTTCACCCTATCCTAATGCCTATGCCTATGGACATGCTACTTGTAACCTTAATCTGACATCCTCTGATTGCAAAACATGTCTTGGTGCTGCTCAAACGGCCTTCTTTAGCACATGCCAGACACCACGGATCGGGGCTCGTTCTGTGCTCTATGATTGTACAATCAAGTACGAGCAATACCCATTTGACGATTAG
Predicted protein sequences of Glyma03g30923
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g30923.1 sequence type=predicted peptide gene model=Glyma03g30923 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGINPTKCVTIAIGLLCLCCVADSVPNTSIINVLCNNGVYTSGELEEETPAQRNYDYHNISPYPNAYAYGHATCNLNLTSSDCKTCLGAAQTAFFSTCQTPRIGARSVLYDCTIKYEQYPFDD*