SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g30800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g30800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g30800

Feature Type:gene_model
Chromosome:Gm03
Start:38658593
stop:38663215
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G48150AT Annotation by Michelle Graham. TAIR10: glutathione peroxidase 4 | chr2:19688109-19689099 REVERSE LENGTH=170 SoyBaseE_val: 4.00E-90ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009688GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid biosynthetic process SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0004602GO-mf Annotation by Michelle Graham. GO Molecular Function: glutathione peroxidase activity SoyBaseN/AISS
KOG1651 KOG Glutathione peroxidase JGI ISS
PTHR11592Panther GLUTATHIONE PEROXIDASE JGI ISS
PF00255PFAM Glutathione peroxidase JGI ISS
UniRef100_I1JNS2UniRef Annotation by Michelle Graham. Best UniRef hit: Glutathione peroxidase n=2 Tax=Glycine max RepID=I1JNS2_SOYBN SoyBaseE_val: 9.00E-122ISS
UniRef100_I1JNS2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutathione peroxidase n=2 Tax=Glycine max RepID=I1JNS2_SOYBN SoyBaseE_val: 9.00E-122ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g30800 not represented in the dataset

Glyma03g30800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma19g33650 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g151500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g30800.1   sequence type=CDS   gene model=Glyma03g30800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGCTTCGCTATCGGTCTCGGAAAAATCCATCCATGAATTCATGGTCAAGGATGCTAAGGGCAGAGACGTGAACCTCAGCATCTACAAAGGGAAGGTTCTTCTTGTAGTAAATGTCGCTTCAAAATGTGGATTTACGAATACCAATTACACCCAGTTAACTGAGCTTTACAGCAAATACAAAGACAGAGGCCTTGAGATACTGGCATTTCCATGCAACCAGTTTCTGAAGCAGGAGCCTGGGAGTAGCCAGGACGTAGAGGAATTTGCCTGCACAAGATACAAGGCCGCGTATCCCATTTTTGGAAAGGTACGTGTCAATGGACCTGATACAGCACCTGTCTACAAATTCCTTAAAGCAAATAAATCAGGATTTCTGGGTTCTAGGATAAAGTGGAATTTCACCAAGTTTTTGGTTGACAAGGAAGGGAATGTCCTCCGGCGTTATGGTTCAACCACCTCACCGTTTTCCATTGAAAATGACATCAAGAGAGCATTGGGGGAGGCTTGA

>Glyma03g30800.1   sequence type=predicted peptide   gene model=Glyma03g30800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGASLSVSEKSIHEFMVKDAKGRDVNLSIYKGKVLLVVNVASKCGFTNTNYTQLTELYSKYKDRGLEILAFPCNQFLKQEPGSSQDVEEFACTRYKAAYPIFGKVRVNGPDTAPVYKFLKANKSGFLGSRIKWNFTKFLVDKEGNVLRRYGSTTSPFSIENDIKRALGEA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo