SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g30686): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g30686): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g30686

Feature Type:gene_model
Chromosome:Gm03
Start:38564054
stop:38565110
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g30686
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G21380AT Annotation by Michelle Graham. TAIR10: Kinesin motor family protein | chr2:9141833-9148883 FORWARD LENGTH=1058 SoyBaseE_val: 6.00E-46ISS
GO:0005982GO-bp Annotation by Michelle Graham. GO Biological Process: starch metabolic process SoyBaseN/AISS
GO:0007018GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule-based movement SoyBaseN/AISS
GO:0007623GO-bp Annotation by Michelle Graham. GO Biological Process: circadian rhythm SoyBaseN/AISS
GO:0003777GO-mf Annotation by Michelle Graham. GO Molecular Function: microtubule motor activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR24115Panther FAMILY NOT NAMED JGI ISS
PTHR24115:SF176Panther SUBFAMILY NOT NAMED JGI ISS
PF00225PFAM Kinesin motor domain JGI ISS
UniRef100_G7JIM7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Kinesin heavy chain-like protein n=1 Tax=Medicago truncatula RepID=G7JIM7_MEDTR SoyBaseE_val: 4.00E-68ISS
UniRef100_I1LPY5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LPY5_SOYBN SoyBaseE_val: 1.00E-81ISS

Expression Patterns of Glyma03g30686
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g30686 not represented in the dataset
Glyma03g30686 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g30686 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g150300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g30686
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g30686
>Glyma03g30686.1   sequence type=CDS   gene model=Glyma03g30686   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCATCCTCACGTGCAAGGAGTAGCTCACCATTCTTGCACCGCAAACCCTCAACTCCTCTTTCCTCAGCTTCCTCTTCCACTTCTTCCTTCACGAACGGACGCATAATGCCTCGCTCCTGTTCCTCTTCCACGTCGTTGTTTTACAACTCCGGTGGTGGTGGACGATCCATGACTCTGAGTCACGGTCACAGCGAGTCTGTCTACTACGGCTATAGTAATCCTTCGCTGGTGGAGTTTGGGATGGACGAGGAGGTGATCACGGAGCTCGTGGATTCGTCCAGAGCTCGAAATAGCATTTTGGTCACGATTCGGTTTAGACCGTTGAGTGAAAGAGAGTACCATAGAGGAGACAAGATCGCGTGGTATGCAGACGATGATAAGATTGTGCGCAATGAGTATAATCCAGCTACTGCTTATTCGTTTGATAGAGTGTTTGGACCACATACGAATTCCGACGAGGTGTATGAAGTAGCTGCCAAACCTGTGGTGAAGACTGCCATGGAAGGTGTAAATGGTATGAAATCTGGATTCAAGGCTTTATATCATTATCACAATGGGAATGTGATATTTTTAGCAGTGTCTGATTTAGTAGCAATAGCAACTATCGATTCATATGTAGTGGTTGTTGGTTTAGTATTACAATGGCTGGTGGAGTTAGCTGGGTTTGGAAGATAA
Predicted protein sequences of Glyma03g30686
>Glyma03g30686.1   sequence type=predicted peptide   gene model=Glyma03g30686   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSSRARSSSPFLHRKPSTPLSSASSSTSSFTNGRIMPRSCSSSTSLFYNSGGGGRSMTLSHGHSESVYYGYSNPSLVEFGMDEEVITELVDSSRARNSILVTIRFRPLSEREYHRGDKIAWYADDDKIVRNEYNPATAYSFDRVFGPHTNSDEVYEVAAKPVVKTAMEGVNGMKSGFKALYHYHNGNVIFLAVSDLVAIATIDSYVVVVGLVLQWLVELAGFGR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo