SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g30440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g30440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g30440

Feature Type:gene_model
Chromosome:Gm03
Start:38389064
stop:38390111
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g30440
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G08880AT Annotation by Michelle Graham. TAIR10: Histone superfamily protein | chr1:2847144-2847676 REVERSE LENGTH=142 SoyBaseE_val: 1.00E-81ISS
GO:0006334GO-bp Annotation by Michelle Graham. GO Biological Process: nucleosome assembly SoyBaseN/AISS
GO:0000786GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleosome SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
KOG1756 KOG Histone 2A JGI ISS
PTHR23430Panther HISTONE H2A JGI ISS
PF00125PFAM Core histone H2A/H2B/H3/H4 JGI ISS
UniRef100_C6TFW1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histone H2A n=1 Tax=Glycine max RepID=C6TFW1_SOYBN SoyBaseE_val: 6.00E-97ISS
UniRef100_UPI000189DA75UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000189DA75 related cluster n=1 Tax=unknown RepID=UPI000189DA75 SoyBaseE_val: 2.00E-97ISS

Expression Patterns of Glyma03g30440
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g30440 not represented in the dataset
Glyma03g30440 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g30440
ParalogEvidenceComments
Glyma19g33360 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g30440 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g148100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g30440
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g30440
>Glyma03g30440.1   sequence type=CDS   gene model=Glyma03g30440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTCCACAGAGGCAGCAGCCACAGAGAAGAAAGGTGGAAGAGGGAAACCGAAGACTTCAAAGTCCGTTTCCCGTTCCTCCAAAGCTGGCCTTCAGTTTCCCGTCGGCCGTGTCGCTCGCTACCTCAAGGCCGGTCGCTACGCCCAGCGCGTTGGCTCCGGTTCCCCTGTTTATCTCTCCGCGGTTCTCGAATACCTCGCTGCCGAGGTTTTGGAGCTTGCGGGGAACGCTGCGAGGGACAACAAGAAGACGAGGATCGTTCCGAGGCACATTCAACTGGCGGTTAGGAACGACGAGGAGTTGAGCAAGCTGATGGGATCTGTGACCATTGCCAACGGTGGTGTTCTGCCTAACATTCACCAGAATTTGTTGCCCAAGAAGGTCGCTGGCAAGGGGAAGACCGAGATTGGATCTGCTAGTCAGGAGTTTTAG
Predicted protein sequences of Glyma03g30440
>Glyma03g30440.1   sequence type=predicted peptide   gene model=Glyma03g30440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSTEAAATEKKGGRGKPKTSKSVSRSSKAGLQFPVGRVARYLKAGRYAQRVGSGSPVYLSAVLEYLAAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLMGSVTIANGGVLPNIHQNLLPKKVAGKGKTEIGSASQEF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo