Glyma03g30420 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g30420

Feature Type:	gene_model
Chromosome:	Gm03
Start:	38374214
stop:	38375630
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g30420

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G13650	AT	Annotation by Michelle Graham. TAIR10: Disease resistance-responsive (dirigent-like protein) family protein \| chr3:4463056-4463616 FORWARD LENGTH=186	SoyBase	E_val: 2.00E-46	ISS
GO:0006598	GO-bp	Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process	SoyBase	N/A	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0009698	GO-bp	Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process	SoyBase	N/A	ISS
GO:0009807	GO-bp	Annotation by Michelle Graham. GO Biological Process: lignan biosynthetic process	SoyBase	N/A	ISS
GO:0042398	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR21495	Panther	NUCLEOPORIN-RELATED	JGI		ISS
PF03018	PFAM	Dirigent-like protein	JGI		ISS
UniRef100_C6SZS9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SZS9_SOYBN	SoyBase	E_val: 4.00E-152	ISS
UniRef100_G7KWC7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Disease resistance response protein n=1 Tax=Medicago truncatula RepID=G7KWC7_MEDTR	SoyBase	E_val: 1.00E-74	ISS

Expression Patterns of Glyma03g30420

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g30420

Paralog	Evidence	Comments
Glyma19g33330	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g30420 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g147900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g30420

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g30420

Limit To All Plant Sequences

>Glyma03g30420.1   sequence type=CDS   gene model=Glyma03g30420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAATTTCATAACTTTCTTCATTCCCCTAGCCCTAACCCTCCTTTTCTCCTCCCTCGTCACTGCCAGTTACCATCAAAGCATCTCTCCAAGCCTTCTACGTTCTCGTGAGAAGCTCACGCACCTTCGCTTCTATTTCCATGAAATTTTTACTAGCGACAAACCCTCTAATCTCGTGATCGACCCCCCCAAGGTGGTAGCCGACTCTCCCCTTCCATTTGGGTCCCAAGTGGTGATCGAGGACCCATTAACAATTGGGCCTGATGTCGAGTCCAAACAGATAGGTAAGGCCCAAGGGTTTTACCTATCCGCAACCCAAAGGCCCGGTTTGGAGTTGGAGATAGTCATGGGGATGGCCTTGACCTTCTTAGAAGGCGAATTTAACGGTAGCAGTTTAAGTGTGTTGGGGAGAAACAAAATCTTCAATGAGGTGAGGGAGTTGCCTATTATTGGTGGCACGGGTGAGTTTCGCTTCGCACGTGGCTATATCCTAGCTAGGAGTGTCAAGGTCGATTACCATAAAGGGGATGCTACCGTGGAATACAACGCTTATGTGTATCATTATTCTTCCACTAGCTCTTCGTCTCACGAGATTTTTAACGATGGAGTTCAGTTCATGACAGACCCTATTCTTAGCAAGATTTAG

Predicted protein sequences of Glyma03g30420

Limit To All Plant Sequences

>Glyma03g30420.1   sequence type=predicted peptide   gene model=Glyma03g30420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANFITFFIPLALTLLFSSLVTASYHQSISPSLLRSREKLTHLRFYFHEIFTSDKPSNLVIDPPKVVADSPLPFGSQVVIEDPLTIGPDVESKQIGKAQGFYLSATQRPGLELEIVMGMALTFLEGEFNGSSLSVLGRNKIFNEVRELPIIGGTGEFRFARGYILARSVKVDYHKGDATVEYNAYVYHYSSTSSSSHEIFNDGVQFMTDPILSKI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain