Glyma03g30390 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g30390

Feature Type:	gene_model
Chromosome:	Gm03
Start:	38349789
stop:	38350349
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g30390

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G42500	AT	Annotation by Michelle Graham. TAIR10: Disease resistance-responsive (dirigent-like protein) family protein \| chr5:16994359-16994916 REVERSE LENGTH=185	SoyBase	E_val: 3.00E-52	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR21495	Panther	NUCLEOPORIN-RELATED	JGI		ISS
PF03018	PFAM	Dirigent-like protein	JGI		ISS
UniRef100_G7KWC3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Disease resistance response protein n=1 Tax=Medicago truncatula RepID=G7KWC3_MEDTR	SoyBase	E_val: 9.00E-111	ISS
UniRef100_I1JNN8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JNN8_SOYBN	SoyBase	E_val: 1.00E-133	ISS

Expression Patterns of Glyma03g30390

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g30390

Paralog	Evidence	Comments
Glyma19g33310	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g30390 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g147700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g30390

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g30390

Limit To All Plant Sequences

>Glyma03g30390.1   sequence type=CDS   gene model=Glyma03g30390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAAATCCACTTTCTTTGTCTGCCTTAACCTTTCATTACTCTTCTCTCTAGTCACAGCCACTTACTACTCAAGTTTAACCCCAACACTTTTGGGTTTTCGCGAGGAGCAGTTCACCCACCTCCACTTCTTCTTCCATGATGTCGTGACAGGCCCAAAGCCCAGCATGGTGTTTATCGCCGAGCCCAACGGGAAAGCGAAGGATGCCCTTCCGTTCGGAACCGTTGTGGCGATGGACGACCCTTTAACCGTGGGGCCCGAACAGGACTCGAAACTTGTGGGCAAGGCCCAAGGAATTTACACTTCAATATCGCAAGAAGAGATGGGACTAATGATGGTGATGACGATGGCATTCACCGATGGAGATTTCAACGGCAGCACCATCAGCGTGTTGGGGAGGAACATGATCATGAGTGAACCTGTTAGGGAAATGGCTATTGTTGGCGGCACTGGGGCTTTTCGTTTTGCACGTGGCTACGCTCAAGCCAGATTTTACTCTGTTGATTTCACCAAAGGAGACGCTATCGTGGAATACGACGTATTCGTGAACCATTATTGA

Predicted protein sequences of Glyma03g30390

Limit To All Plant Sequences

>Glyma03g30390.1   sequence type=predicted peptide   gene model=Glyma03g30390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKSTFFVCLNLSLLFSLVTATYYSSLTPTLLGFREEQFTHLHFFFHDVVTGPKPSMVFIAEPNGKAKDALPFGTVVAMDDPLTVGPEQDSKLVGKAQGIYTSISQEEMGLMMVMTMAFTDGDFNGSTISVLGRNMIMSEPVREMAIVGGTGAFRFARGYAQARFYSVDFTKGDAIVEYDVFVNHY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain