Glyma03g30180 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g30180

Feature Type:	gene_model
Chromosome:	Gm03
Start:	38130952
stop:	38133498
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g30180

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G06720	AT	Annotation by Michelle Graham. TAIR10: peroxidase 2 \| chr5:2077567-2078857 REVERSE LENGTH=335	SoyBase	E_val: 8.00E-170	ISS
GO:0002215	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to nematode	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0009908	GO-bp	Annotation by Michelle Graham. GO Biological Process: flower development	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0004601	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peroxidase activity	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
PF00141	PFAM	Peroxidase	JGI		ISS
UniRef100_G7KVF1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Peroxidase n=1 Tax=Medicago truncatula RepID=G7KVF1_MEDTR	SoyBase	E_val: 0	ISS
UniRef100_I1JNL7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JNL7_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma03g30180

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g30180

Paralog	Evidence	Comments
Glyma19g33080	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g30180 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g145600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g30180

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g30180

Limit To All Plant Sequences

>Glyma03g30180.1   sequence type=CDS   gene model=Glyma03g30180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTTCTTTTAATTACCTATTCACCACCATTTTCTTAGTGCTAACATTCTTTCTTTATCCATCAAATGCTCAACTGAGTTCAACCTTCTACTCCAGCACATGCCCCAACGTGTCTTCCATTGTGCGCAGTGTTGTTCAGCAGGCTCTGCAATCTGATCCTCGAATTGCTGCGAGCCTAACTCGTCTTCATTTTCATGATTGCTTTGTTAATGGATGTGATGGATCCATTTTGTTAGACGTAGGTGGCAACATAACACTGAGCGAGAAAACTGCAGGTCCCAACAATAATTCGGCTCGTGGCTTTGATGTGGTCGACAACATAAAGACATCTATTGAAAATTCATGCCCCGGTGTTGTATCTTGTGCTGATATTCTTGCCCTTGCTGCTGAAGTTTCGGTGTCTTTGGGAGGAGGTCCTTCATGGAACGTACTACTAGGAAGAAGGGACGGTTTGATTGCAAACCAATCTGGTGCGAACACATCCATTCCCAATCCAACAGAAAGCCTGGCCAATGTCACTGCCAAATTTGCTGCCGTTGGCCTAAACATAACTGATCTCGTTGCATTATCTGGTGCACATAGTTTTGGTCGTGCGCAGTGTAGATTTTTCAACCAGAGACTGTTCAACTTCAGCGGCACAGGTAGCCCTGATCCCACGCTGAATACAACCTATTTAGCGACACTTCAGCAAAACTGTCCACAAAACGGAAGCGGCAACACTCTGAACAACCTCGACCCTTCGTCTCCGGACACCTTCGACAACAACTACTTCCAAAACCTTCTCAGCAATCAGGGCCTTCTCCAAACAGACCAAGAGCTCTTTTCCACCAACGGCGCCGCCACAGTTTCCGTCGTCAACAACTTCGCCGCCAACCAAACCGCGTTCTTCCAAGCCTTTGCTCAGTCCATGATTAACATGGGTAATATTAGCCCGTTGACTGGAAGCCAGGGTGAAATCAGATCAGATTGTAAAAGGGTCAATGGAAGTTAA

Predicted protein sequences of Glyma03g30180

Limit To All Plant Sequences

>Glyma03g30180.1   sequence type=predicted peptide   gene model=Glyma03g30180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFSFNYLFTTIFLVLTFFLYPSNAQLSSTFYSSTCPNVSSIVRSVVQQALQSDPRIAASLTRLHFHDCFVNGCDGSILLDVGGNITLSEKTAGPNNNSARGFDVVDNIKTSIENSCPGVVSCADILALAAEVSVSLGGGPSWNVLLGRRDGLIANQSGANTSIPNPTESLANVTAKFAAVGLNITDLVALSGAHSFGRAQCRFFNQRLFNFSGTGSPDPTLNTTYLATLQQNCPQNGSGNTLNNLDPSSPDTFDNNYFQNLLSNQGLLQTDQELFSTNGAATVSVVNNFAANQTAFFQAFAQSMINMGNISPLTGSQGEIRSDCKRVNGS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain