Glyma03g30040 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g30040

Feature Type:	gene_model
Chromosome:	Gm03
Start:	38031153
stop:	38032426
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g30040

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G06760	AT	Annotation by Michelle Graham. TAIR10: Late Embryogenesis Abundant 4-5 \| chr5:2089754-2090313 REVERSE LENGTH=158	SoyBase	E_val: 5.00E-40	ISS
GO:0006970	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to osmotic stress	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009790	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0048316	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed development	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF03760	PFAM	Late embryogenesis abundant (LEA) group 1	JGI		ISS
UniRef100_Q01527	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Maturation protein n=2 Tax=Glycine RepID=Q01527_SOYBN	SoyBase	E_val: 4.00E-102	ISS
UniRef100_Q01527	UniRef	Annotation by Michelle Graham. Best UniRef hit: Maturation protein n=2 Tax=Glycine RepID=Q01527_SOYBN	SoyBase	E_val: 4.00E-102	ISS

Expression Patterns of Glyma03g30040

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g30040

Paralog	Evidence	Comments
Glyma19g32920	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g30040 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g144400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g30040

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g30040

Limit To All Plant Sequences

>Glyma03g30040.1   sequence type=CDS   gene model=Glyma03g30040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGGGAGGAAAGAAAGCTGGAGAGTCCATCAAGGAAACAGCTGCAAACATTGGTGCTTCTGCCAAGGCTGGCATGGAGAAAACCAAGGCCACTGTCCAGGAGAAGGCAGAAAGAATGACGGCACGTGATCCGATGCAAAAGGAGTTGGCAACCCAGAAGAAAGAGGCAAAGATGAGCCAGGCAGAGCTGGACAAGCAGGCGGCGCGTCAGCATAACACGGCGGCGAAGCAGGCTGCCACGGCAGGGCACATGGGACAACCCATGGGGACCCATCAGACGTCAGCTATGCCCGGTCATGGAACCGGACAGCCCACGGGCCATGTCACCGAGGGAGTGGTGGGCTCACACCCTATTGGAACCAACAGAGGCCCGGGTGGGACTGCTACGGCCCATAATACCCGTGCGGGGGGAAACCCAAATGATTATGGGTATGGAACTGGGGGTACTTACAATTAA

Predicted protein sequences of Glyma03g30040

Limit To All Plant Sequences

>Glyma03g30040.1   sequence type=predicted peptide   gene model=Glyma03g30040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQGGKKAGESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPMQKELATQKKEAKMSQAELDKQAARQHNTAAKQAATAGHMGQPMGTHQTSAMPGHGTGQPTGHVTEGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGGTYN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain