SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g29910

Feature Type:gene_model
Chromosome:Gm03
Start:37922846
stop:37925029
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g29910
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G57930AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G42190.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr3:21447250-21447675 REVERSE LENGTH=141 SoyBaseE_val: 1.00E-29ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6T4N2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T4N2_SOYBN SoyBaseE_val: 2.00E-90ISS
UniRef100_G7KVB6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Metal tolerance protein n=1 Tax=Medicago truncatula RepID=G7KVB6_MEDTR SoyBaseE_val: 2.00E-66ISS

Expression Patterns of Glyma03g29910
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g29910
ParalogEvidenceComments
Glyma19g32810 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g29910 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g143200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g29910
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g29910
>Glyma03g29910.1   sequence type=CDS   gene model=Glyma03g29910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCAGAGGCAGAGGAAAAGGGAAGAAGCAATCTGTTATTGCTGAGGATCCTGGAAGTGGTGAAGAGGATAAAGTCCCAGCTTATAGAAGAAGGGGAAGACCAGTGAAGCCACTAACAGATGAAATTGAAGAAGTGGAAGTAACTGAAATAATTGAGAAAGACGAGGAGAATGTGAAAGGCAATGGTTCTACGGATGATTTGAAAACTCAGGCTATCACAGTTAATAAAAGAAAAAGGAAGAGATCTACACAGGTTAAAGAGAAGATAGATCCCTTGAAAGAGGACAATGGCATCCTAGCAAAGTCAGGCCCTGAAGATTCAATAAAGACTACTGGATTCCGACAGAATGGTAGCCGGCGTAAGAACAAGCCTCACCGTGCTGCTGAAGCTGGGGTAGATTGCAAGTGA
Predicted protein sequences of Glyma03g29910
>Glyma03g29910.1   sequence type=predicted peptide   gene model=Glyma03g29910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRGRGKGKKQSVIAEDPGSGEEDKVPAYRRRGRPVKPLTDEIEEVEVTEIIEKDEENVKGNGSTDDLKTQAITVNKRKRKRSTQVKEKIDPLKEDNGILAKSGPEDSIKTTGFRQNGSRRKNKPHRAAEAGVDCK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo