Report for Sequence Feature Glyma03g29701
Feature Type: gene_model
Chromosome: Gm03
Start: 37741913
stop: 37743314
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g29701
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G57790 AT
Annotation by Michelle Graham. TAIR10: Pectin lyase-like superfamily protein | chr3:21405387-21407088 REVERSE LENGTH=490
SoyBase E_val: 2.00E-13 ISS
GO:0005975 GO-bp
Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0005774 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane
SoyBase N/A ISS
GO:0004650 GO-mf
Annotation by Michelle Graham. GO Molecular Function: polygalacturonase activity
SoyBase N/A ISS
UniRef100_G7KUF1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Polygalacturonase n=2 Tax=Medicago truncatula RepID=G7KUF1_MEDTR
SoyBase E_val: 2.00E-21 ISS
UniRef100_I1N942 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N942_SOYBN
SoyBase E_val: 6.00E-29 ISS
Expression Patterns of Glyma03g29701
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma03g29701
Paralog Evidence Comments
Glyma19g32550 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g29701 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g141000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g29701
Coding sequences of Glyma03g29701
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g29701.1 sequence type=CDS gene model=Glyma03g29701 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGATGATGGAGCACATTGAAGGGCTTGAGGTGAAAAAAGTTGAAATGAGATGGTCAAACAGTCAACTAGAGCAGTGGAATAATCCTCTAGAGTTTAGGCCATCTACTGTGAATAACATCTCTTTCCTTAATTTTAATTCTGGTTCGTATACAAATAGTAAATCAAGTTATAAACTTTGGGTCTGCAAAGGGAGAATGTCCAAATCTTTGGCTGCTTGCTTAACCATCAAGGGAACGGGGGAACAGTTCAAAAGAAGGGAGGAGCATTTGTTCTGCACTATAAAAAAATTAGAGAGAGAGAGATCAATTGTTAAATCTTGTTCTAGTGCTTCACTTTCTGCATCTGTAATATGA
Predicted protein sequences of Glyma03g29701
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g29701.1 sequence type=predicted peptide gene model=Glyma03g29701 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MMMEHIEGLEVKKVEMRWSNSQLEQWNNPLEFRPSTVNNISFLNFNSGSYTNSKSSYKLWVCKGRMSKSLAACLTIKGTGEQFKRREEHLFCTIKKLERERSIVKSCSSASLSASVI*