Report for Sequence Feature Glyma03g29620
Feature Type: gene_model
Chromosome: Gm03
Start: 37659490
stop: 37660316
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g29620
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_I1JNF8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JNF8_SOYBN
SoyBase E_val: 1.00E-38 ISS
Expression Patterns of Glyma03g29620
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma03g29620
Paralog Evidence Comments
Glyma19g32450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g29620 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g139900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g29620
Coding sequences of Glyma03g29620
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g29620.1 sequence type=CDS gene model=Glyma03g29620 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAAAACTTGCTGGCTGTGTAGCTCATTTTTTTATTGCAGCAATGGTTTTGAGCACGTTTTACGTGACCAAAACTGTGGCACAATCAGAGATAGCTCCTACTTCACAAATGGAGACTGGAGAAGGGTTTGCTTTGTCTGTTTCTGGGGTGACCTTGTGTTCTTCTCTGTTGGCTTCTATTGTGGCGTTTATGATGCAGTGA
Predicted protein sequences of Glyma03g29620
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g29620.1 sequence type=predicted peptide gene model=Glyma03g29620 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAKLAGCVAHFFIAAMVLSTFYVTKTVAQSEIAPTSQMETGEGFALSVSGVTLCSSLLASIVAFMMQ*