Glyma03g29180 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g29180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g29180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g29180

Feature Type:	gene_model
Chromosome:	Gm03
Start:	37137277
stop:	37139208
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g29180

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G56990	AT	Annotation by Michelle Graham. TAIR10: embryo sac development arrest 7 \| chr3:21088358-21091976 REVERSE LENGTH=711	SoyBase	E_val: 3.00E-23	ISS
GO:0000741	GO-bp	Annotation by Michelle Graham. GO Biological Process: karyogamy	SoyBase	N/A	ISS
GO:0006406	GO-bp	Annotation by Michelle Graham. GO Biological Process: mRNA export from nucleus	SoyBase	N/A	ISS
GO:0006606	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into nucleus	SoyBase	N/A	ISS
GO:0009560	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation	SoyBase	N/A	ISS
GO:0009561	GO-bp	Annotation by Michelle Graham. GO Biological Process: megagametogenesis	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0080008	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR14927	Panther	UNCHARACTERIZED	JGI		ISS
UniRef100_G7IR59	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nucleolar protein n=1 Tax=Medicago truncatula RepID=G7IR59_MEDTR	SoyBase	E_val: 4.00E-27	ISS
UniRef100_I1L412	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L412_SOYBN	SoyBase	E_val: 8.00E-31	ISS

Expression Patterns of Glyma03g29180

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g29180 not represented in the dataset	Glyma03g29180 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g29180 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g135700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g29180

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g29180

Limit To All Plant Sequences

>Glyma03g29180.1   sequence type=CDS   gene model=Glyma03g29180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAACTTCTTGAAGACTTGCGCTTCACCACTACCGCCACCAAAATCAAGGCCACTCCCGACGGCGAGTACATCATTGCTTCCGGCATCTATCCGCCGCAAGTCAAGGTCTACAAGGTCAAGGAGCTAGGCTTGAAGTTCGAACACCACTTGGATTTCGAGATCGTTGATTTTCAACTTCATGTATTAGTTGCCTGTGGTGGTGAAGATGGTGTTGTGGAATGCTTTGACATGCGAGTGAGATCTTCAATTGGAAGAATTGATGTTGTTGGACCTAGTGGTGATGTTAACCAGGAGATCACTGCATTGGAGTTTGATGAAGATGGTGGTTTCTTAATGGTCGTTGGAAGTAGTGCAGGAAAGGTATGA

Predicted protein sequences of Glyma03g29180

Limit To All Plant Sequences

>Glyma03g29180.1   sequence type=predicted peptide   gene model=Glyma03g29180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQLLEDLRFTTTATKIKATPDGEYIIASGIYPPQVKVYKVKELGLKFEHHLDFEIVDFQLHVLVACGGEDGVVECFDMRVRSSIGRIDVVGPSGDVNQEITALEFDEDGGFLMVVGSSAGKV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain