Glyma03g29166 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g29166): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g29166): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g29166

Feature Type:	gene_model
Chromosome:	Gm03
Start:	37131324
stop:	37132236
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g29166

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G21090	AT	Annotation by Michelle Graham. TAIR10: ABC-2 type transporter family protein \| chr3:7391497-7394933 REVERSE LENGTH=691	SoyBase	E_val: 2.00E-29	ISS
GO:0009062	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process	SoyBase	N/A	ISS
GO:0080167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to karrikin	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
GO:0017111	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity	SoyBase	N/A	ISS
GO:0042626	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of substances	SoyBase	N/A	ISS
PTHR19241	Panther	ATP-BINDING CASSETTE TRANSPORTER	JGI		ISS
PTHR19241:SF20	Panther	ABC TRANSPORTER	JGI		ISS
UniRef100_B9HNY9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: White-brown-complex ABC transporter family n=1 Tax=Populus trichocarpa RepID=B9HNY9_POPTR	SoyBase	E_val: 5.00E-32	ISS
UniRef100_I1JNB8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JNB8_SOYBN	SoyBase	E_val: 6.00E-86	ISS

Expression Patterns of Glyma03g29166

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g29166 not represented in the dataset	Glyma03g29166 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g29166 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g135500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g29166

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g29166

Limit To All Plant Sequences

>Glyma03g29166.1   sequence type=CDS   gene model=Glyma03g29166   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTTTGATGATGCTCTTTTGTTGTGAAACACAGGGTCAGTTCAAGAATGACCTGATAGGTCTTGAATTTGAACCACAGGTGCCCGGGGGTACCAAGATAAAGGGTGAAGAGATACTTCATGATATGTTTGGAATTCGAAATGATTACTCAAAATGGTGGGACTTAGGAGTTCTGGTTTTGTTCTTGATATGTTATAGGTTGCTCTTTTTCTTGGTTCTTAAGCACAAGGAGAGAGTTACATCATTATTACACACCAAAAGAACTATCCCAGACATTTTACTCAGAAGATCCTCATTGAAGAACAAATATATCTCTTCGAAGCAACGTCAATCCCTGCATCCTTTGTCAGCTCAAGAGGGTCTTTACTCTCCAATTTCTTAA

Predicted protein sequences of Glyma03g29166

Limit To All Plant Sequences

>Glyma03g29166.1   sequence type=predicted peptide   gene model=Glyma03g29166   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MILMMLFCCETQGQFKNDLIGLEFEPQVPGGTKIKGEEILHDMFGIRNDYSKWWDLGVLVLFLICYRLLFFLVLKHKERVTSLLHTKRTIPDILLRRSSLKNKYISSKQRQSLHPLSAQEGLYSPIS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain