Glyma03g28991 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g28991): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g28991): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g28991

Feature Type:	gene_model
Chromosome:	Gm03
Start:	36944406
stop:	36945494
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g28991

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G60820	AT	Annotation by Michelle Graham. TAIR10: N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein \| chr3:22472038-22473809 REVERSE LENGTH=223	SoyBase	E_val: 2.00E-17	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0006635	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009817	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction	SoyBase	N/A	ISS
GO:0043161	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0043248	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome assembly	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0051603	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis involved in cellular protein catabolic process	SoyBase	N/A	ISS
GO:0051788	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to misfolded protein	SoyBase	N/A	ISS
GO:0080129	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly	SoyBase	N/A	ISS
GO:0000502	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005839	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome core complex	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0004175	GO-mf	Annotation by Michelle Graham. GO Molecular Function: endopeptidase activity	SoyBase	N/A	ISS
GO:0004298	GO-mf	Annotation by Michelle Graham. GO Molecular Function: threonine-type endopeptidase activity	SoyBase	N/A	ISS
GO:0008233	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peptidase activity	SoyBase	N/A	ISS
UniRef100_C6SY64	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Proteasome subunit beta type n=1 Tax=Glycine max RepID=C6SY64_SOYBN	SoyBase	E_val: 3.00E-15	ISS
UniRef100_I1N1H3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N1H3_SOYBN	SoyBase	E_val: 2.00E-15	ISS

Expression Patterns of Glyma03g28991

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g28991 not represented in the dataset	Glyma03g28991 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g28991 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g134000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g28991

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g28991

Limit To All Plant Sequences

>Glyma03g28991.1   sequence type=CDS   gene model=Glyma03g28991   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCAAGCAAGAAGCTAATTGGTCTCCATACGATAACAACGGAGGATCATGTGTTGCAATTGCTGGAGCAGATTACTGCGTCATCACCGCGGATACGAGATACGAGGATGTCCACCGCTTACAATATCCTCACTCGCGATTACTCCAAAATCTCCCAATTGTCAGCTTCAATGTTGAAACAATTATTGCATCATACTAG

Predicted protein sequences of Glyma03g28991

Limit To All Plant Sequences

>Glyma03g28991.1   sequence type=predicted peptide   gene model=Glyma03g28991   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTKQEANWSPYDNNGGSCVAIAGADYCVITADTRYEDVHRLQYPHSRLLQNLPIVSFNVETIIASY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain