Report for Sequence Feature Glyma03g28920
Feature Type: gene_model
Chromosome: Gm03
Start: 36878459
stop: 36881819
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g28920
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G04000 AT
Annotation by Michelle Graham. TAIR10: unknown protein; Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr5:1079305-1079732 REVERSE LENGTH=116
SoyBase E_val: 2.00E-29 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1JN99 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JN99_SOYBN
SoyBase E_val: 1.00E-100 ISS
Expression Patterns of Glyma03g28920
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma03g28920
Paralog Evidence Comments
Glyma19g31630 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g28920 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g133400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g28920
Coding sequences of Glyma03g28920
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g28920.1 sequence type=CDS gene model=Glyma03g28920 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGAACAAATCAAATAAAATGCTGCATGATAATAAGGAGGGCATTCAAGTTGACAACACATCGACTAACACCAATCATCCAGAGATTGGTGTGGACAAAGGTGTTTTGAAGAATTTTACAAGATCTTCAGGGGATGTTGCAGAGACAAAGATAGCAGCTGATTGGAAAGGTGGAGAGAATTGTCCAAAGGGTACACGTCCTGAGGAAATTGATGCATCTGGGGATGTAAACATGGAGGCATCCATAACACCTGATGATGTTATTCGGGCTGGAGGATTTGGTGCAAGAGATGATATCAGTAGCTTTCTTCCTGTTGCAAGTGATTCTACCGACTTCGAAGCTTCAATCCGAGATGCGCGTGATTATGAAGAACCACAGGGTCAAGTAAGCAGGCCAGGCCTTGGCTGGACTGGTGCTACTAAGGGGGAGTGA
Predicted protein sequences of Glyma03g28920
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g28920.1 sequence type=predicted peptide gene model=Glyma03g28920 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MENKSNKMLHDNKEGIQVDNTSTNTNHPEIGVDKGVLKNFTRSSGDVAETKIAADWKGGENCPKGTRPEEIDASGDVNMEASITPDDVIRAGGFGARDDISSFLPVASDSTDFEASIRDARDYEEPQGQVSRPGLGWTGATKGE*