SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g28360

Feature Type:gene_model
Chromosome:Gm03
Start:36253217
stop:36254217
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g28360
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G41180AT Annotation by Michelle Graham. TAIR10: VQ motif-containing protein | chr2:17165242-17165667 FORWARD LENGTH=141 SoyBaseE_val: 7.00E-14ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF05678PFAM VQ motif JGI ISS
UniRef100_I1JN53UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JN53_SOYBN SoyBaseE_val: 2.00E-119ISS
UniRef100_O80669UniRef Annotation by Michelle Graham. Most informative UniRef hit: Sigma factor binding protein 2, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=SIB2_ARATH SoyBaseE_val: 3.00E-11ISS

Proteins Associated with Glyma03g28360
LocusGene SymbolProtein Name
VQ7 VQ motif containing protein gene 7

Expression Patterns of Glyma03g28360
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g28360
ParalogEvidenceComments
Glyma19g31080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g28360 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g127800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g28360
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g28360
>Glyma03g28360.1   sequence type=CDS   gene model=Glyma03g28360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACACCATTCGCAGTACCACCACCATCAGCGTGCAACAAAGAACCCCCACAAAGAAAACCAAGCCCAAGAAAAAGAACACCCCTCACCCAGTGAAGGTAGTGTACATATCCAACCCCATGAAGATCAAGACCAGCGCATCCGAGTTTAGGGCTTTGGTGCAAGAGCTCACCGGCCAGGACGCCGAGTCCCCGCCAGATCCCACCCGCTTCCACGGCCTAATTCACCCTGATTCCTCCTCTTCTGTCGATCACATCGAAGAGGAAGAGGACAATGTTCACAGTGTGAATTGTGTTGTTCCTCCCGCAGTCGCCGACGAGAATATGAGCCTCGCCGGCTGCTACGAGGAGGAACAACAACAACAGCCTTCCTCGATGGAGAGTATAAATAATTTCGAGCCGCTGGACGACGACGACGTTTTCACGCCCCAGATGATAGAGAACATCTCCGCCCTGCTCCCAGCAAGTGTATTCTATGAATCCCCTCATCTTAATCACTGGTGA
Predicted protein sequences of Glyma03g28360
>Glyma03g28360.1   sequence type=predicted peptide   gene model=Glyma03g28360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDTIRSTTTISVQQRTPTKKTKPKKKNTPHPVKVVYISNPMKIKTSASEFRALVQELTGQDAESPPDPTRFHGLIHPDSSSSVDHIEEEEDNVHSVNCVVPPAVADENMSLAGCYEEEQQQQPSSMESINNFEPLDDDDVFTPQMIENISALLPASVFYESPHLNHW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo