SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g27970

Feature Type:gene_model
Chromosome:Gm03
Start:35773797
stop:35777130
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g27970
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G12250AT Annotation by Michelle Graham. TAIR10: beta-6 tubulin | chr5:3961317-3962971 REVERSE LENGTH=449 SoyBaseE_val: 0ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0006084GO-bp Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006184GO-bp Annotation by Michelle Graham. GO Biological Process: GTP catabolic process SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0007017GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule-based process SoyBaseN/AISS
GO:0007018GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule-based movement SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009740GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0051258GO-bp Annotation by Michelle Graham. GO Biological Process: protein polymerization SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005874GO-cc Annotation by Michelle Graham. GO Cellular Compartment: microtubule SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0015630GO-cc Annotation by Michelle Graham. GO Cellular Compartment: microtubule cytoskeleton SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
GO:0005200GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of cytoskeleton SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG1375 KOG Beta tubulin JGI ISS
PTHR11588Panther TUBULIN JGI ISS
PF00091PFAM Tubulin/FtsZ family, GTPase domain JGI ISS
PF03953PFAM Tubulin C-terminal domain JGI ISS
UniRef100_Q2TFP1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Tubulin B4 n=1 Tax=Glycine max RepID=Q2TFP1_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q2TFP1UniRef Annotation by Michelle Graham. Best UniRef hit: Tubulin B4 n=1 Tax=Glycine max RepID=Q2TFP1_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma03g27970
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g27970
ParalogEvidenceComments
Glyma19g30770 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g27970 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g124400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g27970
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g27970
>Glyma03g27970.1   sequence type=CDS   gene model=Glyma03g27970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGGAGATCCTTCACGTTCAGGGAGGGCAATGCGGGAACCAGATCGGTTCGAAGTTCTGGGAAGTGGTGTGCGACGAGCACGGCATAGATCCGACGGGGAAGTACGTCGGAAACTCAGATCTACAACTCGAGCGCGTGAACGTGTACTACAACGAAGCTTCCTGCGGGCGGTTTGTCCCACGCGCAGTGCTGATGGACCTGGAGCCCGGAACCATGGACAGCGTGCGGACTGGGCCGTACGGGCAGATATTCCGGCCCGACAACTTCGTGTTCGGGCAGTCCGGCGCGGGCAACAACTGGGCCAAGGGGCACTACACGGAGGGCGCCGAGCTCATCGACTCCGTCCTTGACGTCGTGCGCAAGGAGGCCGAGAACTGCGACTGCCTCCAGGGGTTCCAGGTCTGCCACTCGCTCGGCGGAGGAACCGGCTCCGGGATGGGGACGCTTTTGATTTCCAAGATCAGAGAGGAGTACCCTGACAGAATGATGCTCACCTTCTCCGTTTTTCCTTCCCCCAAGGTCTCTGATACTGTGGTTGAGCCTTATAACGCTACTCTTTCTGTTCATCAGTTGGTGGAGAATGCTGATGAGTGTATGGTGCTTGATAATGAGGCGCTCTACGATATCTGCTTCAGGACTCTCAAGTTGACCACTCCTAGCTTTGGTGACTTGAACCACTTGATCTCTGCGACCATGAGTGGTGTTACATGCTGTCTTCGATTCCCTGGTCAACTCAACTCTGATCTGAGGAAATTGGCCGTGAATCTCATTCCCTTCCCTCGTCTGCACTTCTTCATGGTTGGATTTGCGCCTCTCACCTCTCGCGGCTCTCAGCAATACCGCGCATTGACAGTGCCAGAGCTGACACAGCAAATGTGGGATGCCAAGAACATGATGTGTGCTGCAGATCCAAGGCACGGGCGTTACCTCACGGCATCAGCCATGTTCCGTGGCAAGATGAGCACCAAGGAGGTGGACGAGCAGATGATAAACGTGCAGAACAAGAACTCTTCATATTTTGTCGAGTGGATTCCCAACAATGTCAAGTCGAGCGTGTGTGACATTGCTCCTAGAGGGCTCTCCATGGCGTCCACATTCATTGGAAACTCGACCTCGATTCAGGAGATGTTCAGGAGGGTGAGTGAGCAGTTCACGGCCATGTTTAGGAGGAAGGCTTTCTTGCATTGGTACACCGGGGAAGGCATGGACGAGATGGAGTTCACAGAGGCAGAGAGCAACATGAACGACCTTGTTTCAGAGTACCAGCAGTACCAGGATGCCACTGCCGAGGATGATGGGGAGTATGAGGACGAGGAGGACGATGATGTTGAAGCAGACCACATGTGA
Predicted protein sequences of Glyma03g27970
>Glyma03g27970.1   sequence type=predicted peptide   gene model=Glyma03g27970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGKYVGNSDLQLERVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIAPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEDDGEYEDEEDDDVEADHM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo