Glyma03g27681 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g27681): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g27681): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g27681

Feature Type:	gene_model
Chromosome:	Gm03
Start:	35456868
stop:	35459126
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g27681

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G78960	AT	Annotation by Michelle Graham. TAIR10: lupeol synthase 2 \| chr1:29696722-29701024 FORWARD LENGTH=763	SoyBase	E_val: 1.00E-54	ISS
GO:0016104	GO-bp	Annotation by Michelle Graham. GO Biological Process: triterpenoid biosynthetic process	SoyBase	N/A	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0019745	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentacyclic triterpenoid biosynthetic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0016866	GO-mf	Annotation by Michelle Graham. GO Molecular Function: intramolecular transferase activity	SoyBase	N/A	ISS
GO:0042299	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lupeol synthase activity	SoyBase	N/A	ISS
GO:0042300	GO-mf	Annotation by Michelle Graham. GO Molecular Function: beta-amyrin synthase activity	SoyBase	N/A	ISS
PTHR11764	Panther	SQUALENE CYCLASES-RELATED	JGI		ISS
PTHR11764:SF3	Panther	CYCLOARTENOL SYNTHASE-RELATED	JGI		ISS
UniRef100_I1JN01	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JN01_SOYBN	SoyBase	E_val: 4.00E-93	ISS
UniRef100_Q2WGL8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Beta-amyrin synthase n=1 Tax=Lotus japonicus RepID=Q2WGL8_LOTJA	SoyBase	E_val: 4.00E-73	ISS

Expression Patterns of Glyma03g27681

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g27681 not represented in the dataset	Glyma03g27681 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g27681 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g121600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g27681

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma03g27681

Limit To All Plant Sequences

>Glyma03g27681.2   sequence type=transcript   gene model=Glyma03g27681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TAAAATATTCTTTGCACTGCCCAAAGGGACCACTCATAGTCCACACTCTCAAATAAAGGCACGGCACCATCATTGGATCTGGATTCTGGTGCCACTCTCTCTTACTCCTCTGTTTTTTCTCCATGGCTAGGGTTTTGATGCTACTAGTAAGCACGAATGGTACAACTACTGTCTAGTCATCTCGCATGAAACAGGTGTTAATCAACATTTATTTGGGGTGATCATATATTTTTTTCCTAAAATAAATTTAGAGAGAGCAACAAAATGTGGAGGCTGAAGATAGCAGATGGTGGAAAAGATCCATACATTTTCAGCACAAACAATTTTGTAGGAAGACAGACATGGGAATTTGATCCTGAGGCAGGAACTCCAGAGGAACGAGCTCAAGTTGAAGCAGCTCGTCAAAATTTCTATAACAACCGTTTCAAGTTCAAGGCCTGTGGTGACCTCCTTTGGCGCTTTCAGATTCTGAGAGAAAATAACTTCAAAGAAACAATATCTAGTGTGAAGATAGAAGATGGAGAGGAAATTACATACGAAAAAGTCACAGCCACGATGACAAGGGCCGCACATTATCTATGTGCATTACAGACTAGTGATGGTCATTGGCCTGCACAAATTGCAGGAGCTATGTTTTTTGTTCCTCCTTTGGTAAGTACTAAATATTCGTATTAG

Coding sequences of Glyma03g27681

Limit To All Plant Sequences

>Glyma03g27681.1   sequence type=CDS   gene model=Glyma03g27681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGAGGCTGAAGATAGCAGATGGTGGAAAAGATCCATACATTTTCAGCACAAACAATTTTGTAGGAAGACAGACATGGGAATTTGATCCTGAGGCAGGAACTCCAGAGGAACGAGCTCAAGTTGAAGCAGCTCGTCAAAATTTCTATAACAACCGTTTCAAGTTCAAGGCCTGTGGTGACCTCCTTTGGCGCTTTCAGATTCTGAGAGAAAATAACTTCAAAGAAACAATATCTAGTGTGAAGATAGAAGATGGAGAGGAAATTACATACGAAAAAGTCACAGCCACGATGACAAGGGCCGCACATTATCTATGTGCATTACAGACTAGTGATGGTCATTGGCCTGCACAAATTGCAGGAGCTATGTTTTTTGTTCCTCCTTTGGTAAGTACTAAATATTCGTATTAG

>Glyma03g27681.2   sequence type=CDS   gene model=Glyma03g27681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGAGGCTGAAGATAGCAGATGGTGGAAAAGATCCATACATTTTCAGCACAAACAATTTTGTAGGAAGACAGACATGGGAATTTGATCCTGAGGCAGGAACTCCAGAGGAACGAGCTCAAGTTGAAGCAGCTCGTCAAAATTTCTATAACAACCGTTTCAAGTTCAAGGCCTGTGGTGACCTCCTTTGGCGCTTTCAGATTCTGAGAGAAAATAACTTCAAAGAAACAATATCTAGTGTGAAGATAGAAGATGGAGAGGAAATTACATACGAAAAAGTCACAGCCACGATGACAAGGGCCGCACATTATCTATGTGCATTACAGACTAGTGATGGTCATTGGCCTGCACAAATTGCAGGAGCTATGTTTTTTGTTCCTCCTTTGGTAAGTACTAAATATTCGTATTAG

Predicted protein sequences of Glyma03g27681

Limit To All Plant Sequences

>Glyma03g27681.1   sequence type=predicted peptide   gene model=Glyma03g27681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWRLKIADGGKDPYIFSTNNFVGRQTWEFDPEAGTPEERAQVEAARQNFYNNRFKFKACGDLLWRFQILRENNFKETISSVKIEDGEEITYEKVTATMTRAAHYLCALQTSDGHWPAQIAGAMFFVPPLVSTKYSY*

>Glyma03g27681.2   sequence type=predicted peptide   gene model=Glyma03g27681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWRLKIADGGKDPYIFSTNNFVGRQTWEFDPEAGTPEERAQVEAARQNFYNNRFKFKACGDLLWRFQILRENNFKETISSVKIEDGEEITYEKVTATMTRAAHYLCALQTSDGHWPAQIAGAMFFVPPLVSTKYSY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain