SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g27531

Feature Type:gene_model
Chromosome:Gm03
Start:35238793
stop:35243055
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g27531
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G45790AT Annotation by Michelle Graham. TAIR10: Ubiquitin carboxyl-terminal hydrolase family protein | chr5:18572345-18573664 FORWARD LENGTH=439 SoyBaseE_val: 3.00E-103ISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
PF11955PFAM Plant organelle RNA recognition domain JGI ISS
UniRef100_F4KEN0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin carboxyl-terminal hydrolase-like protein n=2 Tax=Arabidopsis thaliana RepID=F4KEN0_ARATH SoyBaseE_val: 1.00E-100ISS
UniRef100_I1JMZ0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JMZ0_SOYBN SoyBaseE_val: 4.00E-166ISS

Expression Patterns of Glyma03g27531
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g27531 not represented in the dataset
Glyma03g27531 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g27531
ParalogEvidenceComments
Glyma19g30510 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g27531 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g120500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g27531
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g27531
>Glyma03g27531.1   sequence type=CDS   gene model=Glyma03g27531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCCGCGCGCAAGCGCGGTCCTTTCATCTCTCTCACCCTCCTCTCCCGCTGGCGAAACATCCTCGGACTCACCGTCCCCGTGGGCCCATTCCTCCACAAATACCCCCACGTCTTCCACGTGTTCGTCCACCCCTTCAGAAAAAACACGTGCTGCAGGGTCACCAAAAGGATGAAAGAATTGACCTTTCTCGAAGGGGTGGTGGTTAAGCAGAATGGAACAGAAGCTGTGAAGAGGGTGAAGAAGCTGCTGATGATGTCCGTGAATGGCACGCTTCGTTTGCACGCCTTAAGGTTGATTAAAAGAGAATTGGGTCTCCCTGAGGATTTCAGAGACTCCATTATTGGAAGGTATGATCGAGATTTCAGATTGGTTGATTTGGAGGTTGTGGCATTGGTTGATTGGGACGCCGAATTTGCGGTGGCTCGGGTTGAGGAATGGAGGGTGAGGGAGTACACTGAAAAGTGGTTGAGTGAGTTCGAGACCAAGTTCGCATTCCCCGTTAGCTTCCCAACCGGGTTTATGTTTGAGAGAGGGTTTAAGGAGAGGCTGAGGAATTGGCAGAGGCTTCCTTACACCATGCCTTACAAGAGGAACGAGGTTGTTCGGGTGAGGACGTGTGGAGGGATCGAGTGGTATGAGAAGAGGGCTGTGGCTGTTCTTCATGAGCTGCTGAGCTTGACTGTGGAGAAGATGGTTGAGGTTGATCGGCTGGCTCATTTTGGAGGGACTTTGGTATCGAAGTTAATGTGCGCGAATTGCTGCTGA
Predicted protein sequences of Glyma03g27531
>Glyma03g27531.1   sequence type=predicted peptide   gene model=Glyma03g27531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPARKRGPFISLTLLSRWRNILGLTVPVGPFLHKYPHVFHVFVHPFRKNTCCRVTKRMKELTFLEGVVVKQNGTEAVKRVKKLLMMSVNGTLRLHALRLIKRELGLPEDFRDSIIGRYDRDFRLVDLEVVALVDWDAEFAVARVEEWRVREYTEKWLSEFETKFAFPVSFPTGFMFERGFKERLRNWQRLPYTMPYKRNEVVRVRTCGGIEWYEKRAVAVLHELLSLTVEKMVEVDRLAHFGGTLVSKLMCANCC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo