SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g27311): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g27311): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g27311

Feature Type:gene_model
Chromosome:Gm03
Start:35017908
stop:35018520
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g27311
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G41120AT Annotation by Michelle Graham. TAIR10: unknown protein; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 10 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF309 (InterPro:IPR005500); Has 349 Blast hits to 349 proteins in 112 species: Archae - 2; Bacteria - 189; Metazoa - 0; Fungi - 0; Plants - 31; Viruses - 0; Other Eukaryotes - 127 (source: NCBI BLink). | chr2:17141454-17142419 REVERSE LENGTH=261 SoyBaseE_val: 2.00E-22ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
PF03745PFAM Domain of unknown function (DUF309) JGI ISS
UniRef100_I1N8K6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N8K6_SOYBN SoyBaseE_val: 8.00E-49ISS
UniRef100_Q2RB12UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=2 Tax=Oryza sativa RepID=Q2RB12_ORYSJ SoyBaseE_val: 3.00E-19ISS

Expression Patterns of Glyma03g27311
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g27311 not represented in the dataset
Glyma03g27311 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g27311 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g119000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g27311
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g27311
>Glyma03g27311.1   sequence type=CDS   gene model=Glyma03g27311   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATTCATCATCATCATCTATGGCTCTTCTTCCTCCTTCTTCTCTCGGAACCCTTTTCCATATCTCATCTCAACATTATCTTCTTAATAATTCCTTTCACAATCCCATCACTCTCACACCATCATCTTTCAATCCACCCACTCATAATTATTCAAAGCAGCACCGGGACCACAGAAGCTTCAACTCCAAGCTCTTGGCTATTTCTTACAGATATTTCATTGAAGAAGAAGATGACGACGATGACAATAAAGGTGAAAACCAGAACTTTGATGAAGCAGTGGCTCTCTTCAACGGAGGAGAGTACTACAAATGCCATGACTATCTTGAAGCACTTTGGCTCAATGCTGAAGAGCCCACCAGAACACTCATTCATGGAATACTGCAATGTGCACTGGATTTCCACCACCTCTTCAACCAGGTTTTCATACATTTAGGCTTAATTACAATTTTATTTCATCGAGATTATTGCTAA
Predicted protein sequences of Glyma03g27311
>Glyma03g27311.1   sequence type=predicted peptide   gene model=Glyma03g27311   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHSSSSSMALLPPSSLGTLFHISSQHYLLNNSFHNPITLTPSSFNPPTHNYSKQHRDHRSFNSKLLAISYRYFIEEEDDDDDNKGENQNFDEAVALFNGGEYYKCHDYLEALWLNAEEPTRTLIHGILQCALDFHHLFNQVFIHLGLITILFHRDYC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo